Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein 10

Gene

RBM10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in post-transcriptional processing, most probably in mRNA splicing. Binds to RNA homopolymers, with a preference for poly(G) and poly(U) and little for poly(A) (By similarity). May bind to specific miRNA hairpins (PubMed:28431233).By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri212 – 242RanBP2-typePROSITE-ProRule annotationAdd BLAST31
Zinc fingeri759 – 784C2H2-type; atypicalPROSITE-ProRule annotationAdd BLAST26

GO - Molecular functioni

  • identical protein binding Source: IntAct
  • metal ion binding Source: UniProtKB-KW
  • miRNA binding Source: UniProtKB
  • protein-containing complex binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionRNA-binding
Biological processmRNA processing, mRNA splicing
LigandMetal-binding, Zinc

Protein family/group databases

MoonDBiP98175 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein 10Curated
Alternative name(s):
G patch domain-containing protein 9
RNA-binding motif protein 10
RNA-binding protein S1-1By similarity
Short name:
S1-1
Gene namesi
Name:RBM10Imported
Synonyms:DXS8237E, GPATC9, GPATCH9, KIAA0122
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000182872.15
HGNCiHGNC:9896 RBM10
MIMi300080 gene
neXtProtiNX_P98175

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

TARP syndrome (TARPS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by the Robin sequence (micrognathia, glossoptosis and cleft palate), talipes equinovarus and cardiac defects.
See also OMIM:311900

Organism-specific databases

DisGeNETi8241
MalaCardsiRBM10
MIMi311900 phenotype
OpenTargetsiENSG00000182872
Orphaneti2886 TARP syndrome
PharmGKBiPA34259

Polymorphism and mutation databases

BioMutaiRBM10
DMDMi218512116

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000817671 – 930RNA-binding protein 10Add BLAST930
Isoform 5 (identifier: P98175-5)
Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei61PhosphoserineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei383N6-acetyllysineCombined sources1
Modified residuei718PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei733PhosphoserineCombined sources1
Modified residuei736PhosphoserineCombined sources1
Modified residuei738PhosphoserineCombined sources1
Modified residuei781PhosphoserineCombined sources1
Modified residuei797PhosphoserineCombined sources1
Modified residuei845PhosphoserineCombined sources1
Modified residuei902Omega-N-methylarginineCombined sources1
Isoform 5 (identifier: P98175-5)
Modified residuei2N-acetylserineCombined sources1
Modified residuei30PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiP98175
MaxQBiP98175
PaxDbiP98175
PeptideAtlasiP98175
PRIDEiP98175
ProteomicsDBi57810
57811 [P98175-2]
57812 [P98175-3]
57813 [P98175-4]

PTM databases

iPTMnetiP98175
PhosphoSitePlusiP98175

Expressioni

Gene expression databases

BgeeiENSG00000182872 Expressed in 218 organ(s), highest expression level in cerebellar hemisphere
CleanExiHS_RBM10
ExpressionAtlasiP98175 baseline and differential
GenevisibleiP98175 HS

Organism-specific databases

HPAiHPA034972
HPA057372

Interactioni

Subunit structurei

Associates with the spliceosome. Component of a large chromatin remodeling complex, at least composed of MYSM1, PCAF, RBM10 and KIF11/TRIP5.1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi113869, 100 interactors
IntActiP98175, 89 interactors
MINTiP98175
STRINGi9606.ENSP00000366829

Structurei

Secondary structure

1930
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP98175
SMRiP98175
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini129 – 209RRM 1PROSITE-ProRule annotationAdd BLAST81
Domaini300 – 384RRM 2PROSITE-ProRule annotationAdd BLAST85
Domaini858 – 904G-patchPROSITE-ProRule annotationAdd BLAST47

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi80 – 87Poly-Arg8
Compositional biasi113 – 125Poly-GluAdd BLAST13
Compositional biasi561 – 607Tyr-richAdd BLAST47

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri212 – 242RanBP2-typePROSITE-ProRule annotationAdd BLAST31
Zinc fingeri759 – 784C2H2-type; atypicalPROSITE-ProRule annotationAdd BLAST26

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG0154 Eukaryota
ENOG410YNFQ LUCA
GeneTreeiENSGT00510000046476
HOVERGENiHBG000318
InParanoidiP98175
KOiK13094
OMAiQDMEYER
OrthoDBiEOG091G01UT
PhylomeDBiP98175
TreeFamiTF315789

Family and domain databases

CDDicd16167 OCRE_RBM10, 1 hit
cd12754 RRM2_RBM10, 1 hit
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR000467 G_patch_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR033095 RBM10
IPR035618 RBM10_OCRE
IPR034992 RBM10_RRM2
IPR000504 RRM_dom
IPR013087 Znf_C2H2_type
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf
PANTHERiPTHR13948:SF4 PTHR13948:SF4, 1 hit
PfamiView protein in Pfam
PF01585 G-patch, 1 hit
PF00076 RRM_1, 1 hit
PF00641 zf-RanBP, 1 hit
SMARTiView protein in SMART
SM00443 G_patch, 1 hit
SM00360 RRM, 2 hits
SM00547 ZnF_RBZ, 1 hit
SUPFAMiSSF54928 SSF54928, 3 hits
SSF90209 SSF90209, 1 hit
PROSITEiView protein in PROSITE
PS50174 G_PATCH, 1 hit
PS50102 RRM, 2 hits
PS01358 ZF_RANBP2_1, 1 hit
PS50199 ZF_RANBP2_2, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P98175-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEYERRGGRG DRTGRYGATD RSQDDGGENR SRDHDYRDMD YRSYPREYGS
60 70 80 90 100
QEGKHDYDDS SEEQSAEDSY EASPGSETQR RRRRRHRHSP TGPPGFPRDG
110 120 130 140 150
DYRDQDYRTE QGEEEEEEED EEEEEKASNI VMLRMLPQAA TEDDIRGQLQ
160 170 180 190 200
SHGVQAREVR LMRNKSSGQS RGFAFVEFSH LQDATRWMEA NQHSLNILGQ
210 220 230 240 250
KVSMHYSDPK PKINEDWLCN KCGVQNFKRR EKCFKCGVPK SEAEQKLPLG
260 270 280 290 300
TRLDQQTLPL GGRELSQGLL PLPQPYQAQG VLASQALSQG SEPSSENAND
310 320 330 340 350
TIILRNLNPH STMDSILGAL APYAVLSSSN VRVIKDKQTQ LNRGFAFIQL
360 370 380 390 400
STIVEAAQLL QILQALHPPL TIDGKTINVE FAKGSKRDMA SNEGSRISAA
410 420 430 440 450
SVASTAIAAA QWAISQASQG GEGTWATSEE PPVDYSYYQQ DEGYGNSQGT
460 470 480 490 500
ESSLYAHGYL KGTKGPGITG TKGDPTGAGP EASLEPGADS VSMQAFSRAQ
510 520 530 540 550
PGAAPGIYQQ SAEASSSQGT AANSQSYTIM SPAVLKSELQ SPTHPSSALP
560 570 580 590 600
PATSPTAQES YSQYPVPDVS TYQYDETSGY YYDPQTGLYY DPNSQYYYNA
610 620 630 640 650
QSQQYLYWDG ERRTYVPALE QSADGHKETG APSKEGKEKK EKHKTKTAQQ
660 670 680 690 700
IAKDMERWAR SLNKQKENFK NSFQPISSLR DDERRESATA DAGYAILEKK
710 720 730 740 750
GALAERQHTS MDLPKLASDD RPSPPRGLVA AYSGESDSEE EQERGGPERE
760 770 780 790 800
EKLTDWQKLA CLLCRRQFPS KEALIRHQQL SGLHKQNLEI HRRAHLSENE
810 820 830 840 850
LEALEKNDME QMKYRDRAAE RREKYGIPEP PEPKRRKYGG ISTASVDFEQ
860 870 880 890 900
PTRDGLGSDN IGSRMLQAMG WKEGSGLGRK KQGIVTPIEA QTRVRGSGLG
910 920 930
ARGSSYGVTS TESYKETLHK TMVTRFNEAQ
Length:930
Mass (Da):103,533
Last modified:December 16, 2008 - v3
Checksum:i472E68F085CA5744
GO
Isoform 2 (identifier: P98175-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-354: Missing.

Show »
Length:929
Mass (Da):103,433
Checksum:i43D8E086250E441B
GO
Isoform 3 (identifier: P98175-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-144: Missing.

Show »
Length:853
Mass (Da):94,469
Checksum:iBF5689F0C926EDA8
GO
Isoform 4 (identifier: P98175-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-144: Missing.
     354-354: Missing.

Show »
Length:852
Mass (Da):94,370
Checksum:iBB39E0CAC9B4A8A3
GO
Isoform 5 (identifier: P98175-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSGSPSLTARAEKVSVDAGRGGGESLQEASPRLADHGSSSGGGWEVKRSQRLRRGPSSPRRPYQDM

Show »
Length:995
Mass (Da):110,366
Checksum:i26D5BC3A47E9E4FB
GO

Sequence cautioni

The sequence AAB33572 differs from that shown. Reason: Frameshift at position 696.Curated
The sequence BAA09471 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB70731 differs from that shown. Reason: Frameshift at several positions.Curated
The sequence CAB70731 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti499A → P in BAA09471 (PubMed:8590280).Curated1
Sequence conflicti672S → T in CAB70731 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035486396R → H in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0593411M → MSGSPSLTARAEKVSVDAGR GGGESLQEASPRLADHGSSS GGGWEVKRSQRLRRGPSSPR RPYQDM in isoform 5. 1
Alternative sequenceiVSP_03617368 – 144Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST77
Alternative sequenceiVSP_036035354Missing in isoform 2 and isoform 4. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50912 mRNA Translation: BAA09471.1 Different initiation.
AK292758 mRNA Translation: BAF85447.1
AL137421 mRNA Translation: CAB70731.1 Sequence problems.
AL513366 Genomic DNA No translation available.
CH471164 Genomic DNA Translation: EAW59284.1
CH471164 Genomic DNA Translation: EAW59285.1
CH471164 Genomic DNA Translation: EAW59286.1
CH471164 Genomic DNA Translation: EAW59287.1
CH471164 Genomic DNA Translation: EAW59283.1
BC003089 mRNA Translation: AAH03089.1
BC004181 mRNA Translation: AAH04181.1
BC008733 mRNA Translation: AAH08733.1
BC024153 mRNA Translation: AAH24153.1
U35373 mRNA Translation: AAB33572.1 Frameshift.
CCDSiCCDS14274.1 [P98175-1]
CCDS56600.1 [P98175-3]
CCDS75969.1 [P98175-5]
CCDS78478.1 [P98175-4]
RefSeqiNP_001191395.1, NM_001204466.1 [P98175-3]
NP_001191396.1, NM_001204467.1 [P98175-2]
NP_001191397.1, NM_001204468.1 [P98175-5]
NP_005667.2, NM_005676.4 [P98175-1]
NP_690595.1, NM_152856.2 [P98175-4]
UniGeneiHs.401509

Genome annotation databases

EnsembliENST00000329236; ENSP00000328848; ENSG00000182872 [P98175-5]
ENST00000345781; ENSP00000329659; ENSG00000182872 [P98175-3]
ENST00000377604; ENSP00000366829; ENSG00000182872 [P98175-1]
ENST00000628161; ENSP00000486115; ENSG00000182872 [P98175-4]
GeneIDi8241
KEGGihsa:8241
UCSCiuc004dhf.4 human [P98175-1]
uc004dhi.4 human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D50912 mRNA Translation: BAA09471.1 Different initiation.
AK292758 mRNA Translation: BAF85447.1
AL137421 mRNA Translation: CAB70731.1 Sequence problems.
AL513366 Genomic DNA No translation available.
CH471164 Genomic DNA Translation: EAW59284.1
CH471164 Genomic DNA Translation: EAW59285.1
CH471164 Genomic DNA Translation: EAW59286.1
CH471164 Genomic DNA Translation: EAW59287.1
CH471164 Genomic DNA Translation: EAW59283.1
BC003089 mRNA Translation: AAH03089.1
BC004181 mRNA Translation: AAH04181.1
BC008733 mRNA Translation: AAH08733.1
BC024153 mRNA Translation: AAH24153.1
U35373 mRNA Translation: AAB33572.1 Frameshift.
CCDSiCCDS14274.1 [P98175-1]
CCDS56600.1 [P98175-3]
CCDS75969.1 [P98175-5]
CCDS78478.1 [P98175-4]
RefSeqiNP_001191395.1, NM_001204466.1 [P98175-3]
NP_001191396.1, NM_001204467.1 [P98175-2]
NP_001191397.1, NM_001204468.1 [P98175-5]
NP_005667.2, NM_005676.4 [P98175-1]
NP_690595.1, NM_152856.2 [P98175-4]
UniGeneiHs.401509

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LXINMR-A128-218[»]
2M2BNMR-A277-408[»]
2MXVNMR-A211-250[»]
2MXWNMR-A558-646[»]
ProteinModelPortaliP98175
SMRiP98175
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113869, 100 interactors
IntActiP98175, 89 interactors
MINTiP98175
STRINGi9606.ENSP00000366829

Protein family/group databases

MoonDBiP98175 Predicted

PTM databases

iPTMnetiP98175
PhosphoSitePlusiP98175

Polymorphism and mutation databases

BioMutaiRBM10
DMDMi218512116

Proteomic databases

EPDiP98175
MaxQBiP98175
PaxDbiP98175
PeptideAtlasiP98175
PRIDEiP98175
ProteomicsDBi57810
57811 [P98175-2]
57812 [P98175-3]
57813 [P98175-4]

Protocols and materials databases

DNASUi8241
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329236; ENSP00000328848; ENSG00000182872 [P98175-5]
ENST00000345781; ENSP00000329659; ENSG00000182872 [P98175-3]
ENST00000377604; ENSP00000366829; ENSG00000182872 [P98175-1]
ENST00000628161; ENSP00000486115; ENSG00000182872 [P98175-4]
GeneIDi8241
KEGGihsa:8241
UCSCiuc004dhf.4 human [P98175-1]
uc004dhi.4 human

Organism-specific databases

CTDi8241
DisGeNETi8241
EuPathDBiHostDB:ENSG00000182872.15
GeneCardsiRBM10
HGNCiHGNC:9896 RBM10
HPAiHPA034972
HPA057372
MalaCardsiRBM10
MIMi300080 gene
311900 phenotype
neXtProtiNX_P98175
OpenTargetsiENSG00000182872
Orphaneti2886 TARP syndrome
PharmGKBiPA34259
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0154 Eukaryota
ENOG410YNFQ LUCA
GeneTreeiENSGT00510000046476
HOVERGENiHBG000318
InParanoidiP98175
KOiK13094
OMAiQDMEYER
OrthoDBiEOG091G01UT
PhylomeDBiP98175
TreeFamiTF315789

Miscellaneous databases

ChiTaRSiRBM10 human
GeneWikiiRBM10
GenomeRNAii8241
PROiPR:P98175
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182872 Expressed in 218 organ(s), highest expression level in cerebellar hemisphere
CleanExiHS_RBM10
ExpressionAtlasiP98175 baseline and differential
GenevisibleiP98175 HS

Family and domain databases

CDDicd16167 OCRE_RBM10, 1 hit
cd12754 RRM2_RBM10, 1 hit
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR000467 G_patch_dom
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR033095 RBM10
IPR035618 RBM10_OCRE
IPR034992 RBM10_RRM2
IPR000504 RRM_dom
IPR013087 Znf_C2H2_type
IPR001876 Znf_RanBP2
IPR036443 Znf_RanBP2_sf
PANTHERiPTHR13948:SF4 PTHR13948:SF4, 1 hit
PfamiView protein in Pfam
PF01585 G-patch, 1 hit
PF00076 RRM_1, 1 hit
PF00641 zf-RanBP, 1 hit
SMARTiView protein in SMART
SM00443 G_patch, 1 hit
SM00360 RRM, 2 hits
SM00547 ZnF_RBZ, 1 hit
SUPFAMiSSF54928 SSF54928, 3 hits
SSF90209 SSF90209, 1 hit
PROSITEiView protein in PROSITE
PS50174 G_PATCH, 1 hit
PS50102 RRM, 2 hits
PS01358 ZF_RANBP2_1, 1 hit
PS50199 ZF_RANBP2_2, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRBM10_HUMAN
AccessioniPrimary (citable) accession number: P98175
Secondary accession number(s): A0A0A0MR66
, C4AM81, Q14136, Q5JRR2, Q9BTE4, Q9BTX0, Q9NTB1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: December 16, 2008
Last modified: September 12, 2018
This is version 185 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again