Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative vitellogenin receptor

Gene

yl

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in uptake of vitellogenin by endocytosis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei1837Critical for endocytosisSequence analysis1
Sitei1878Critical for endocytosisSequence analysis1
Sitei1892Critical for endocytosisSequence analysis1

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • vitellogenin receptor activity Source: FlyBase

GO - Biological processi

  • oogenesis Source: FlyBase

Keywordsi

Molecular functionReceptor
Biological processEndocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
Putative vitellogenin receptor
Alternative name(s):
Protein yolkless
Short name:
YL
Gene namesi
Name:yl
ORF Names:CG1372
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome X

Organism-specific databases

FlyBaseiFBgn0004649 yl

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini? – 1800ExtracellularSequence analysis
Transmembranei1801 – 1821HelicalSequence analysisAdd BLAST21
Topological domaini1822 – 1984CytoplasmicSequence analysisAdd BLAST163

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000007781? – 1984Putative vitellogenin receptor
Signal peptidei1 – ?Sequence analysis

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi30N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi90 ↔ 102By similarity
Disulfide bondi97 ↔ 115By similarity
Disulfide bondi109 ↔ 124By similarity
Disulfide bondi129 ↔ 144By similarity
Disulfide bondi137 ↔ 157By similarity
Disulfide bondi151 ↔ 166By similarity
Disulfide bondi184 ↔ 197By similarity
Disulfide bondi191 ↔ 210By similarity
Disulfide bondi204 ↔ 220By similarity
Disulfide bondi227 ↔ 239By similarity
Disulfide bondi234 ↔ 253By similarity
Disulfide bondi247 ↔ 262By similarity
Disulfide bondi266 ↔ 281By similarity
Disulfide bondi275 ↔ 294By similarity
Disulfide bondi288 ↔ 304By similarity
Disulfide bondi310 ↔ 321By similarity
Disulfide bondi315 ↔ 331By similarity
Disulfide bondi333 ↔ 346By similarity
Disulfide bondi352 ↔ 363By similarity
Disulfide bondi359 ↔ 372By similarity
Glycosylationi365N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi374 ↔ 387By similarity
Glycosylationi384N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi429N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi664 ↔ 673By similarity
Glycosylationi666N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi669 ↔ 685By similarity
Disulfide bondi687 ↔ 700By similarity
Glycosylationi749N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi782N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi988 ↔ 999By similarity
Disulfide bondi995 ↔ 1009By similarity
Disulfide bondi1011 ↔ 1025By similarity
Glycosylationi1022N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1031 ↔ 1040By similarity
Disulfide bondi1035 ↔ 1053By similarity
Disulfide bondi1047 ↔ 1062By similarity
Disulfide bondi1074 ↔ 1087By similarity
Disulfide bondi1081 ↔ 1100By similarity
Disulfide bondi1094 ↔ 1109By similarity
Disulfide bondi1118 ↔ 1130By similarity
Disulfide bondi1125 ↔ 1143By similarity
Disulfide bondi1137 ↔ 1152By similarity
Disulfide bondi1158 ↔ 1170By similarity
Disulfide bondi1165 ↔ 1183By similarity
Disulfide bondi1177 ↔ 1193By similarity
Disulfide bondi1198 ↔ 1210By similarity
Disulfide bondi1205 ↔ 1223By similarity
Disulfide bondi1217 ↔ 1232By similarity
Glycosylationi1240N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1243 ↔ 1257By similarity
Disulfide bondi1250 ↔ 1270By similarity
Disulfide bondi1264 ↔ 1279By similarity
Glycosylationi1265N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1283 ↔ 1296By similarity
Disulfide bondi1290 ↔ 1309By similarity
Disulfide bondi1303 ↔ 1318By similarity
Glycosylationi1326N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1340 ↔ 1352By similarity
Disulfide bondi1347 ↔ 1365By similarity
Disulfide bondi1359 ↔ 1375By similarity
Disulfide bondi1379 ↔ 1392By similarity
Disulfide bondi1388 ↔ 1401By similarity
Disulfide bondi1403 ↔ 1416By similarity
Disulfide bondi1422 ↔ 1432By similarity
Disulfide bondi1428 ↔ 1441By similarity
Disulfide bondi1443 ↔ 1456By similarity
Glycosylationi1475N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1490N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1738 ↔ 1747By similarity
Disulfide bondi1743 ↔ 1756By similarity
Disulfide bondi1758 ↔ 1769By similarity
Modified residuei1926Phosphoserine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP98163
PRIDEiP98163

PTM databases

iPTMnetiP98163

Expressioni

Tissue specificityi

Ovary.

Gene expression databases

BgeeiFBgn0004649
GenevisibleiP98163 DM

Interactioni

Protein-protein interaction databases

BioGridi58737, 8 interactors
IntActiP98163, 8 interactors
MINTiP98163
STRINGi7227.FBpp0073715

Structurei

3D structure databases

ProteinModelPortaliP98163
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini89 – 125LDL-receptor class A 1PROSITE-ProRule annotationAdd BLAST37
Domaini128 – 167LDL-receptor class A 2PROSITE-ProRule annotationAdd BLAST40
Domaini183 – 221LDL-receptor class A 3PROSITE-ProRule annotationAdd BLAST39
Domaini226 – 263LDL-receptor class A 4PROSITE-ProRule annotationAdd BLAST38
Domaini265 – 305LDL-receptor class A 5PROSITE-ProRule annotationAdd BLAST41
Domaini306 – 347EGF-like 1PROSITE-ProRule annotationAdd BLAST42
Domaini348 – 388EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Repeati441 – 485LDL-receptor class B 1Add BLAST45
Repeati486 – 528LDL-receptor class B 2Add BLAST43
Repeati529 – 572LDL-receptor class B 3Add BLAST44
Repeati573 – 614LDL-receptor class B 4Add BLAST42
Repeati615 – 649LDL-receptor class B 5Add BLAST35
Domaini660 – 701EGF-like 3PROSITE-ProRule annotationAdd BLAST42
Repeati750 – 792LDL-receptor class B 6Add BLAST43
Repeati793 – 836LDL-receptor class B 7Add BLAST44
Repeati884 – 925LDL-receptor class B 8Add BLAST42
Repeati934 – 976LDL-receptor class B 9Add BLAST43
Domaini984 – 1026EGF-like 4PROSITE-ProRule annotationAdd BLAST43
Domaini1024 – 1063LDL-receptor class A 6PROSITE-ProRule annotationAdd BLAST40
Domaini1073 – 1110LDL-receptor class A 7PROSITE-ProRule annotationAdd BLAST38
Domaini1117 – 1153LDL-receptor class A 8PROSITE-ProRule annotationAdd BLAST37
Domaini1157 – 1194LDL-receptor class A 9PROSITE-ProRule annotationAdd BLAST38
Domaini1197 – 1233LDL-receptor class A 10PROSITE-ProRule annotationAdd BLAST37
Domaini1242 – 1280LDL-receptor class A 11PROSITE-ProRule annotationAdd BLAST39
Domaini1282 – 1319LDL-receptor class A 12PROSITE-ProRule annotationAdd BLAST38
Domaini1339 – 1376LDL-receptor class A 13PROSITE-ProRule annotationAdd BLAST38
Domaini1375 – 1417EGF-like 5PROSITE-ProRule annotationAdd BLAST43
Domaini1418 – 1457EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Repeati1588 – 1637LDL-receptor class B 10Add BLAST50
Repeati1638 – 1687LDL-receptor class B 11Add BLAST50
Domaini1734 – 1770EGF-like 7PROSITE-ProRule annotationAdd BLAST37

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPSU Eukaryota
ENOG410YUAB LUCA
GeneTreeiENSGT00760000118968
InParanoidiP98163
OMAiDEHDKCG
OrthoDBiEOG091G00V3
PhylomeDBiP98163

Family and domain databases

CDDicd00112 LDLa, 13 hits
Gene3Di2.120.10.30, 3 hits
InterProiView protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR026823 cEGF
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR036055 LDL_receptor-like_sf
IPR023415 LDLR_class-A_CS
IPR000033 LDLR_classB_rpt
IPR002172 LDrepeatLR_classA_rpt
PfamiView protein in Pfam
PF12662 cEGF, 1 hit
PF07645 EGF_CA, 1 hit
PF00057 Ldl_recept_a, 12 hits
PF00058 Ldl_recept_b, 3 hits
PRINTSiPR00261 LDLRECEPTOR
SMARTiView protein in SMART
SM00181 EGF, 7 hits
SM00179 EGF_CA, 4 hits
SM00192 LDLa, 13 hits
SM00135 LY, 10 hits
SUPFAMiSSF57424 SSF57424, 13 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 2 hits
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 3 hits
PS01187 EGF_CA, 2 hits
PS01209 LDLRA_1, 12 hits
PS50068 LDLRA_2, 13 hits
PS51120 LDLRB, 10 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: P98163-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCQAEHQVHP SEQRIRVESP KMTASRRGFN LTSQTRAHPS SGGSTSSRYG
60 70 80 90 100
NCQRTHLIIN GRHVAISLLL LVGLCGGTAA GTPGSADTRC DAGQFQCRDG
110 120 130 140 150
GCILQAKMCD GRGDCKDSSD ELDCDYRLCR PPHWFPCAQP HGACLAAELM
160 170 180 190 200
CNGIDNCPGG EDELNCPVRP GFRFGDTAHR MRSCSKYEFM CQQDRTCIPI
210 220 230 240 250
DFMCDGRPDC TDKSDEVAGC KQAEITCPGE GHLCANGRCL RRKQWVCDGV
260 270 280 290 300
DDCGDGSDER GCLNLCEPQK GKFLCRNRET CLTLSEVCDG HSDCSDGSDE
310 320 330 340 350
TDLCHSKPDC DAKKCALGAK CHMMPASGAE CFCPKGFRLA KFEDKCEDVD
360 370 380 390 400
ECKEQDDLCS QGCENTSGGY RCVCDAGYLL DKDNRTCRAV VYGSKEQQPL
410 420 430 440 450
LLYTTQMTIM GMHLREDNVR NHVYQVAGNL SKVIGVAYDG SHIYWTNIQN
460 470 480 490 500
EAESIVKANG DGSNAEILLT SGLDAPEDLA VDWLTQNIYF SDNIMRHIAV
510 520 530 540 550
CSNDGLNCAV LVTQDVHQPR SLAVWPQKGL MFWTDWGEKP MIGRASMDGS
560 570 580 590 600
RSRPIVSDNI EWPNGIALDM HQQRIYWVDA KLGSVQTVRP DGTGRRTVLD
610 620 630 640 650
GMLKHPYGLA IFEDQLYWSD WATKSVHACH KFSGKDHRIL AKDRTIYAVH
660 670 680 690 700
IYHPAKQPNS PHGCENATCS HLCLLAEPEI GGHSCACPDG MRLAPDHRRC
710 720 730 740 750
MLMEKRQRLF IGLGQVLLEI EHTAFGRHQV SKSYTLPCLI NEMVYNRING
760 770 780 790 800
SLIIADNDQR LILEFQPESH ESNVLVRSNL GNVSALAFDH LSRNLYWADT
810 820 830 840 850
ERAVIEVLSL QTRHRALIRF FPGQEVPIGL TVMPAEGYLY VVLKAKRHSH
860 870 880 890 900
IDKIPLSGKG EQVHVFEDDL GDDDIKLVTD YETQTIFWSD SDLGRISYSN
910 920 930 940 950
YRVPHSQIFR GKLRRPYSLA MVHHDLFWNE LGTPRIYWTH KSNMGPRKVI
960 970 980 990 1000
DIMEKDDPAA IMPYVPVATP NGIPLAASSP VGQESHPCQQ QNGGCSHICV
1010 1020 1030 1040 1050
GEGPYHSICL CPAGFVYRDA GNRTCVEALD CEFRCHSGEC LTMNHRCNGR
1060 1070 1080 1090 1100
RDCVDNSDEM NCDEEHRRKP KVLCSPNQFA CHSGEQCVDK ERRCDNRKDC
1110 1120 1130 1140 1150
HDHSDEQHCE KFDKSKKCHV HQHGCDNGKC VDSSLVCDGT NDCGDNSDEL
1160 1170 1180 1190 1200
LCEATSRCEP GMFQCGSGSC IAGSWECDGR IDCSDGSDEH DKCVHRSCPP
1210 1220 1230 1240 1250
DMQRCLLGQC LDRSLVCDGH NDCGDKSDEL NCGTDSSTMN ISCAEDQYQC
1260 1270 1280 1290 1300
TSNLKICLPS TVRCNGTTEC PRGEDEADCG DVCSIYEFKC RSGRECIRRE
1310 1320 1330 1340 1350
FRCDGQKDCG DGSDELSCEL EKGHHNQSQI QPWSTSSRSC RPHLFDCQDG
1360 1370 1380 1390 1400
ECVDLSRVCN NFPDCTNGHD EGPKCATACR SASGRQVCQH KCRATPAGAV
1410 1420 1430 1440 1450
CSCFDGYRLD ADQKSCLDID ECQEQQPCAQ LCENTLGGYQ CQCHADFMLR
1460 1470 1480 1490 1500
QDRVSCKSLQ SGATLLFSSF NEVRNLSEQP VMLNVAWSAN DSRITGFDLA
1510 1520 1530 1540 1550
MHRQMGYFSA EDEGIVYQID LQTKVIVRAL GLPAPTKLSV DWVTGNVYVL
1560 1570 1580 1590 1600
SGAQEIQACS FVGRMCGRIV HVKSPRHVKH LAVDGYHARI FYIVIRTEGY
1610 1620 1630 1640 1650
GQTSSEIHMA RLDGSRRDML LQRSESFMTA LTTDPHQQLL YFVDQHMRTL
1660 1670 1680 1690 1700
ERISYRLKTG PMRRPEIMLQ KSNALMHPSG LSVYENNAFI VNLGSVEAVQ
1710 1720 1730 1740 1750
CALYGSRICH KISINVLNAQ DIVVAGRSRQ PQKASHPCAH AHCHGLCLQA
1760 1770 1780 1790 1800
DYGYECMCGN RLVAEGERCP HGSGNEVAVL GAVNSLELEH EHEQNGHFHW
1810 1820 1830 1840 1850
LMALFVLAAG SLIAGLGYMY YQYRQRGHTD LNINMHFQNP LATLGGTKAF
1860 1870 1880 1890 1900
LEHERAEAGV GFTTETGTVS SRGSNDTFTT TSATSSFAAQ QFSVPNALQR
1910 1920 1930 1940 1950
LLRPRQSASG DPMAQELLLE SPSRESKLHA LDGGGAGGDG DGGRGVGRQV
1960 1970 1980
PDILVADMDD DAAKSAGQFG GNYAGNDANA RFVS
Note: No experimental confirmation available.
Length:1,984
Mass (Da):219,521
Last modified:May 10, 2004 - v2
Checksum:i0B6F9CF4EFC4914C
GO
Isoform A (identifier: P98163-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1925-1984: ESKLHALDGGGAGGDGDGGRGVGRQVPDILVADMDDDAAKSAGQFGGNYAGNDANARFVS → VSSDGGQMAVEDM

Show »
Length:1,937
Mass (Da):214,968
Checksum:iBB5A09AF1096FEBA
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti457K → E in AAO39481 (Ref. 4) Curated1
Sequence conflicti470T → S in AAO39481 (Ref. 4) Curated1
Sequence conflicti727R → A in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1068R → H in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1077N → S in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1156S → L in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1203Q → H in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1207L → S in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1261T → A in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1519I → V in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1696V → M in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1884T → S in AAB60217 (PubMed:7878005).Curated1
Sequence conflicti1944R → C in AAB60217 (PubMed:7878005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0103001925 – 1984ESKLH…ARFVS → VSSDGGQMAVEDM in isoform A. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U13637 mRNA Translation: AAB60217.1
AE014298 Genomic DNA Translation: AAF48349.2
AE014298 Genomic DNA Translation: AAS65339.1
BT003478 mRNA Translation: AAO39481.1
PIRiT13171
RefSeqiNP_511151.2, NM_078596.3 [P98163-2]
NP_996433.1, NM_206710.2 [P98163-1]

Genome annotation databases

EnsemblMetazoaiFBtr0073897; FBpp0073714; FBgn0004649 [P98163-2]
FBtr0073898; FBpp0073715; FBgn0004649 [P98163-1]
GeneIDi32367
KEGGidme:Dmel_CG1372

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiYL_DROME
AccessioniPrimary (citable) accession number: P98163
Secondary accession number(s): Q86P52, Q9VY56
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 10, 2004
Last modified: July 18, 2018
This is version 159 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health