Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P98095 (FBLN2_HUMAN)

Entry version 192 (07 Apr 2021)
Sequence version 2 (03 Mar 2009)
Previous versions | rss
Add a publicationFeedback
Protein

Fibulin-2

Gene

FBLN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Its binding to fibronectin and some other ligands is calcium dependent. May act as an adapter that mediates the interaction between FBN1 and ELN (PubMed:17255108).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandCalcium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P98095

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-2129379, Molecules associated with elastic fibres

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fibulin-2
Short name:
FIBL-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FBLN2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:3601, FBLN2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		135821, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P98095

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000163520.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		2199

Open Targets

More...OpenTargetsi		ENSG00000163520

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28014

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P98095, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FBLN2

Domain mapping of disease mutations (DMDM)

More...DMDMi		224471827

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 27Sequence analysisAdd BLAST27
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000756828 – 1184Fibulin-2Add BLAST1157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi180N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei277PhosphoserineCombined sources1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi445 ↔ 472By similarity
Disulfide bondi446 ↔ 479By similarity
Disulfide bondi459 ↔ 480By similarity
Disulfide bondi489 ↔ 518By similarity
Disulfide bondi502 ↔ 519By similarity
Glycosylationi507N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi521 ↔ 545By similarity
Disulfide bondi522 ↔ 552By similarity
Disulfide bondi535 ↔ 553By similarity
Disulfide bondi608 ↔ 620By similarity
Disulfide bondi616 ↔ 629By similarity
Disulfide bondi631 ↔ 644By similarity
Disulfide bondi683 ↔ 693By similarity
Disulfide bondi689 ↔ 702By similarity
Disulfide bondi704 ↔ 717By similarity
Disulfide bondi723 ↔ 736By similarity
Disulfide bondi730 ↔ 745By similarity
Disulfide bondi751 ↔ 762By similarity
Disulfide bondi768 ↔ 781By similarity
Disulfide bondi775 ↔ 790By similarity
Disulfide bondi796 ↔ 808By similarity
Disulfide bondi814 ↔ 827By similarity
Disulfide bondi821 ↔ 836By similarity
Disulfide bondi843 ↔ 856By similarity
Disulfide bondi862 ↔ 875By similarity
Disulfide bondi869 ↔ 884By similarity
Disulfide bondi886 ↔ 899By similarity
Disulfide bondi905 ↔ 917By similarity
Disulfide bondi913 ↔ 926By similarity
Disulfide bondi928 ↔ 941By similarity
Disulfide bondi947 ↔ 956By similarity
Disulfide bondi952 ↔ 965By similarity
Disulfide bondi967 ↔ 980By similarity
Disulfide bondi986 ↔ 998By similarity
Disulfide bondi994 ↔ 1007By similarity
Disulfide bondi1009 ↔ 1023By similarity
Disulfide bondi1029 ↔ 1042By similarity
Glycosylationi1035N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi1036 ↔ 1051By similarity
Disulfide bondi1056 ↔ 1068By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated with core 1 or possibly core 8 glycans. It is unsure if the O-glycosylation is on Thr-347 or Ser-348.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P98095

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P98095

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P98095

MaxQB - The MaxQuant DataBase

More...MaxQBi		P98095

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P98095

PeptideAtlas

More...PeptideAtlasi		P98095

PRoteomics IDEntifications database

More...PRIDEi		P98095

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		57790 [P98095-1]
57791 [P98095-2]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		751, 8 N-Linked glycans (2 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P98095, 19 sites, 5 O-linked glycans (16 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P98095

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P98095

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163520, Expressed in right atrium auricular region and 206 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P98095, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P98095, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000163520, Tissue enhanced (heart)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotrimer; disulfide-linked.

Interacts with LAMA2 (By similarity).

Interacts with FBN1 (via N-terminal domain).

Forms a ternary complex with ELN and FBN1 (PubMed:17255108).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108493, 45 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P98095

Protein interaction database and analysis system

More...IntActi		P98095, 15 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000384169

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P98095, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P98095

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini445 – 480Anaphylatoxin-like 1PROSITE-ProRule annotationAdd BLAST36
Domaini488 – 519Anaphylatoxin-like 2PROSITE-ProRule annotationAdd BLAST32
Domaini521 – 553Anaphylatoxin-like 3PROSITE-ProRule annotationAdd BLAST33
Domaini604 – 645EGF-like 1; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini679 – 718EGF-like 2PROSITE-ProRule annotationAdd BLAST40
Domaini719 – 763EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST45
Domaini764 – 809EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST46
Domaini810 – 857EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST48
Domaini858 – 900EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini901 – 942EGF-like 7; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini943 – 981EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd BLAST39
Domaini982 – 1024EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini1025 – 1069EGF-like 10; calcium-bindingPROSITE-ProRule annotationAdd BLAST45

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni28 – 444NAdd BLAST417
Regioni28 – 177Subdomain NA (Cys-rich)Add BLAST150
Regioni178 – 444Subdomain NB (Cys-free)Add BLAST267
Regioni1070 – 1184Domain IIIAdd BLAST115

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the fibulin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1217, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156047

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_268948_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P98095

Identification of Orthologs from Complete Genome Data

More...OMAi		CHCPNAG

Database for complete collections of gene phylogenies

More...PhylomeDBi		P98095

TreeFam database of animal gene trees

More...TreeFami		TF317514

Family and domain databases

Conserved Domains Database

More...CDDi		cd00017, ANATO, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000020, Anaphylatoxin/fibulin
IPR026823, cEGF
IPR001881, EGF-like_Ca-bd_dom
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR018097, EGF_Ca-bd_CS
IPR037286, Fibulin-2
IPR009030, Growth_fac_rcpt_cys_sf

The PANTHER Classification System

More...PANTHERi		PTHR24039:SF32, PTHR24039:SF32, 2 hits

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01821, ANATO, 1 hit
PF12662, cEGF, 2 hits
PF07645, EGF_CA, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00104, ANATO, 3 hits
SM00181, EGF, 11 hits
SM00179, EGF_CA, 9 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57184, SSF57184, 4 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01177, ANAPHYLATOXIN_1, 3 hits
PS01178, ANAPHYLATOXIN_2, 3 hits
PS00010, ASX_HYDROXYL, 5 hits
PS01186, EGF_2, 5 hits
PS50026, EGF_3, 4 hits
PS01187, EGF_CA, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P98095-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLLWEPAGA WLALGLALAL GPSVAAAAPR QDCTGVECPP LENCIEEALE 
        60         70         80         90        100
PGACCATCVQ QGCACEGYQY YDCLQGGFVR GRVPAGQSYF VDFGSTECSC 
       110        120        130        140        150
PPGGGKISCQ FMLCPELPPN CIEAVVVADS CPQCGQVGCV HAGHKYAAGH 
       160        170        180        190        200
TVHLPPCRAC HCPDAGGELI CYQLPGCHGN FSDAEEGDPE RHYEDPYSYD 
       210        220        230        240        250
QEVAEVEAAT ALGGEVQAGA VQAGAGGPPA ALGGGSQPLS TIQAPPWPAV 
       260        270        280        290        300
LPRPTAAAAL GPPAPVQAKA RRVTEDSEEE EEEEEEREEM AVTEQLAAGG 
       310        320        330        340        350
HRGLDGLPTT APAGPSLPIQ EERAEAGARA EAGARPEENL ILDAQATSRS 
       360        370        380        390        400
TGPEGVTHAP SLGKAALVPT QAVPGSPRDP VKPSPHNILS TSLPDAAWIP 
       410        420        430        440        450
PTREVPRKPQ VLPHSHVEED TDPNSVHSIP RSSPEGSTKD LIETCCAAGQ 
       460        470        480        490        500
QWAIDNDECL EIPESGTEDN VCRTAQRHCC VSYLQEKSCM AGVLGAKEGE 
       510        520        530        540        550
TCGAEDNDSC GISLYKQCCD CCGLGLRVRA EGQSCESNPN LGYPCNHVML 
       560        570        580        590        600
SCCEGEEPLI VPEVRRPPEP AAAPRRVSEA EMAGREALSL GTEAELPNSL 
       610        620        630        640        650
PGDDQDECLL LPGELCQHLC INTVGSYHCA CFPGFSLQDD GRTCRPEGHP 
       660        670        680        690        700
PQPEAPQEPA LKSEFSQVAS NTIPLPLPQP NTCKDNGPCK QVCSTVGGSA 
       710        720        730        740        750
ICSCFPGYAI MADGVSCEDI NECVTDLHTC SRGEHCVNTL GSFHCYKALT 
       760        770        780        790        800
CEPGYALKDG ECEDVDECAM GTHTCQPGFL CQNTKGSFYC QARQRCMDGF 
       810        820        830        840        850
LQDPEGNCVD INECTSLSEP CRPGFSCINT VGSYTCQRNP LICARGYHAS 
       860        870        880        890        900
DDGTKCVDVN ECETGVHRCG EGQVCHNLPG SYRCDCKAGF QRDAFGRGCI 
       910        920        930        940        950
DVNECWASPG RLCQHTCENT LGSYRCSCAS GFLLAADGKR CEDVNECEAQ 
       960        970        980        990       1000
RCSQECANIY GSYQCYCRQG YQLAEDGHTC TDIDECAQGA GILCTFRCLN 
      1010       1020       1030       1040       1050
VPGSYQCACP EQGYTMTANG RSCKDVDECA LGTHNCSEAE TCHNIQGSFR 
      1060       1070       1080       1090       1100
CLRFECPPNY VQVSKTKCER TTCHDFLECQ NSPARITHYQ LNFQTGLLVP 
      1110       1120       1130       1140       1150
AHIFRIGPAP AFTGDTIALN IIKGNEEGYF GTRRLNAYTG VVYLQRAVLE 
      1160       1170       1180 
PRDFALDVEM KLWRQGSVTT FLAKMHIFFT TFAL
Length:1,184
Mass (Da):126,573
Last modified:March 3, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD46890D93518B343
GO
Isoform 2 (identifier: P98095-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     718-718: E → EDQDECLMGAHDCSRRQFCVNTLGSFYCVNHTVLCADGYILNAHRKCV

Show »
Length:1,231
Mass (Da):131,863
Checksum:i914C7630E2D9FC4E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JQS6C9JQS6_HUMAN
Fibulin-2
FBLN2
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BXL0H7BXL0_HUMAN
Fibulin-2
FBLN2
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1A3H7C1A3_HUMAN
Fibulin-2
FBLN2
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti145K → E in CAA57876 (PubMed:7806230).Curated1
Sequence conflicti145K → E in AAN05436 (Ref. 2) Curated1
Sequence conflicti664E → G in BAH14261 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06115945I → V. Corresponds to variant dbSNP:rs60850813Ensembl.1
Natural variantiVAR_061160144H → R. Corresponds to variant dbSNP:rs28587534Ensembl.1
Natural variantiVAR_059266361S → G. Corresponds to variant dbSNP:rs3732666Ensembl.1
Natural variantiVAR_059267387N → T. Corresponds to variant dbSNP:rs3796318Ensembl.1
Natural variantiVAR_059268854T → A1 PublicationCorresponds to variant dbSNP:rs9843344Ensembl.1
Natural variantiVAR_0557221114G → R. Corresponds to variant dbSNP:rs1061375Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041404718E → EDQDECLMGAHDCSRRQFCV NTLGSFYCVNHTVLCADGYI LNAHRKCV in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X82494 mRNA Translation: CAA57876.1
AY130458, AY130456, AY130457 Genomic DNA Translation: AAN05435.1
AY130459 mRNA Translation: AAN05436.1
AK304827 mRNA Translation: BAH14261.1
AC090509 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS46761.1 [P98095-2]
CCDS46762.1 [P98095-1]

Protein sequence database of the Protein Information Resource

More...PIRi		A55184

NCBI Reference Sequences

More...RefSeqi		NP_001004019.1, NM_001004019.1 [P98095-2]
NP_001158507.1, NM_001165035.1 [P98095-2]
NP_001989.2, NM_001998.2 [P98095-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000295760; ENSP00000295760; ENSG00000163520 [P98095-1]
ENST00000404922; ENSP00000384169; ENSG00000163520 [P98095-2]
ENST00000492059; ENSP00000420042; ENSG00000163520 [P98095-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2199

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2199

UCSC genome browser

More...UCSCi		uc011ava.3, human [P98095-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82494 mRNA Translation: CAA57876.1
AY130458, AY130456, AY130457 Genomic DNA Translation: AAN05435.1
AY130459 mRNA Translation: AAN05436.1
AK304827 mRNA Translation: BAH14261.1
AC090509 Genomic DNA No translation available.
CCDSiCCDS46761.1 [P98095-2]
CCDS46762.1 [P98095-1]
PIRiA55184
RefSeqiNP_001004019.1, NM_001004019.1 [P98095-2]
NP_001158507.1, NM_001165035.1 [P98095-2]
NP_001989.2, NM_001998.2 [P98095-1]

3D structure databases

SMRiP98095
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi108493, 45 interactors
CORUMiP98095
IntActiP98095, 15 interactors
STRINGi9606.ENSP00000384169

PTM databases

GlyConnecti751, 8 N-Linked glycans (2 sites)
GlyGeniP98095, 19 sites, 5 O-linked glycans (16 sites)
iPTMnetiP98095
PhosphoSitePlusiP98095

Genetic variation databases

BioMutaiFBLN2
DMDMi224471827

Proteomic databases

EPDiP98095
jPOSTiP98095
MassIVEiP98095
MaxQBiP98095
PaxDbiP98095
PeptideAtlasiP98095
PRIDEiP98095
ProteomicsDBi57790 [P98095-1]
57791 [P98095-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1165, 263 antibodies

Genome annotation databases

EnsembliENST00000295760; ENSP00000295760; ENSG00000163520 [P98095-1]
ENST00000404922; ENSP00000384169; ENSG00000163520 [P98095-2]
ENST00000492059; ENSP00000420042; ENSG00000163520 [P98095-2]
GeneIDi2199
KEGGihsa:2199
UCSCiuc011ava.3, human [P98095-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2199
DisGeNETi2199

GeneCards: human genes, protein and diseases

More...GeneCardsi		FBLN2
HGNCiHGNC:3601, FBLN2
HPAiENSG00000163520, Tissue enhanced (heart)
MIMi135821, gene
neXtProtiNX_P98095
OpenTargetsiENSG00000163520
PharmGKBiPA28014
VEuPathDBiHostDB:ENSG00000163520.13

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1217, Eukaryota
GeneTreeiENSGT00940000156047
HOGENOMiCLU_268948_0_0_1
InParanoidiP98095
OMAiCHCPNAG
PhylomeDBiP98095
TreeFamiTF317514

Enzyme and pathway databases

PathwayCommonsiP98095
ReactomeiR-HSA-2129379, Molecules associated with elastic fibres

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2199, 1 hit in 987 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FBLN2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FBLN2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2199
PharosiP98095, Tbio

Protein Ontology

More...PROi		PR:P98095
RNActiP98095, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000163520, Expressed in right atrium auricular region and 206 other tissues
ExpressionAtlasiP98095, baseline and differential
GenevisibleiP98095, HS

Family and domain databases

CDDicd00017, ANATO, 2 hits
InterProiView protein in InterPro
IPR000020, Anaphylatoxin/fibulin
IPR026823, cEGF
IPR001881, EGF-like_Ca-bd_dom
IPR000742, EGF-like_dom
IPR000152, EGF-type_Asp/Asn_hydroxyl_site
IPR018097, EGF_Ca-bd_CS
IPR037286, Fibulin-2
IPR009030, Growth_fac_rcpt_cys_sf
PANTHERiPTHR24039:SF32, PTHR24039:SF32, 2 hits
PfamiView protein in Pfam
PF01821, ANATO, 1 hit
PF12662, cEGF, 2 hits
PF07645, EGF_CA, 5 hits
SMARTiView protein in SMART
SM00104, ANATO, 3 hits
SM00181, EGF, 11 hits
SM00179, EGF_CA, 9 hits
SUPFAMiSSF57184, SSF57184, 4 hits
PROSITEiView protein in PROSITE
PS01177, ANAPHYLATOXIN_1, 3 hits
PS01178, ANAPHYLATOXIN_2, 3 hits
PS00010, ASX_HYDROXYL, 5 hits
PS01186, EGF_2, 5 hits
PS50026, EGF_3, 4 hits
PS01187, EGF_CA, 9 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFBLN2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P98095
Secondary accession number(s): B7Z9C5, Q8IUI0, Q8IUI1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: March 3, 2009
Last modified: April 7, 2021
This is version 192 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again