UniProtKB - P98066 (TSG6_HUMAN)

BLAST

>sp|P98066|TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL

Align
Format
Add to basket Added to basket
History
Entry version 170 (07 Nov 2018)
Sequence version 2 (21 Jun 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Tumor necrosis factor-inducible gene 6 protein

Gene

TNFAIP6

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis.

GO - Molecular functionⁱ

hyaluronic acid binding
Source: ProtInc
Traceable author statementⁱ
- 1730767

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell adhesion Source: UniProtKB-KW
cell-cell signaling
Source: ProtInc
Traceable author statementⁱ
- 1730767
inflammatory response
Source: ProtInc
Traceable author statementⁱ
- 1730767
negative regulation of inflammatory response
Source: CACAO
Inferred from direct assayⁱ
- 21569482
neutrophil degranulation Source: Reactome
ovulation Source: Ensembl
positive regulation of cell migration Source: Ensembl
signal transduction
Source: ProtInc
Traceable author statementⁱ
- 1730767

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Cell adhesion

Biological process

Cell adhesion

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation
SIGNORⁱ	P98066

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Tumor necrosis factor-inducible gene 6 protein Alternative name(s): Hyaluronate-binding protein TNF-stimulated gene 6 protein Short name: TSG-6 Tumor necrosis factor alpha-induced protein 6 Short name: TNF alpha-induced protein 6
Gene namesⁱ	Name:TNFAIP6 Synonyms:TSG6
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000123610.4
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11898 TNFAIP6
MIMⁱ	600410 gene
neXtProtⁱ	NX_P98066

Subcellular locationⁱ

GO - Cellular component

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	7130
Open Targets More...OpenTargetsⁱ	ENSG00000123610
PharmGKBⁱ	PA36595

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB08818 Hyaluronic acid

DrugBankⁱ

DB08818 Hyaluronic acid

Polymorphism and mutation databases

BioMutaⁱ	TNFAIP6
DMDMⁱ	68067717

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 17	1 PublicationAdd BLAST		17
ChainⁱPRO_0000026692	18 – 277	Tumor necrosis factor-inducible gene 6 proteinAdd BLAST		260

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	58 ↔ 127
Disulfide bondⁱ	82 ↔ 103
Glycosylationⁱ	118	N-linked (GlcNAc...) asparagineSequence analysis	1
Disulfide bondⁱ	135 ↔ 161	By similarity
Disulfide bondⁱ	188 ↔ 210	By similarity
Glycosylationⁱ	258	N-linked (GlcNAc...) asparagineSequence analysis	1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbⁱ	P98066
PeptideAtlas More...PeptideAtlasⁱ	P98066
PRIDEⁱ	P98066
ProteomicsDBⁱ	57783

PTM databases

iPTMnetⁱ	P98066
PhosphoSitePlusⁱ	P98066

Expressionⁱ

Tissue specificityⁱ

Found in the synovial fluid of patients with rheumatoid arthritis.1 Publication

Inductionⁱ

By TNF.

Gene expression databases

Bgeeⁱ	ENSG00000123610 Expressed in 178 organ(s), highest expression level in layer of synovial tissue
CleanExⁱ	HS_TNFAIP6
Genevisibleⁱ	P98066 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB032719 HPA050884

HPAⁱ

CAB032719
HPA050884

Interactionⁱ

Subunit structureⁱ

Interacts with inter-alpha-inhibitor (I-alpha-I). Chondroitin sulfate may be required for the stability of the complex.1 Publication

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
BMP2	P12643	3	EBI-11700693,EBI-9697918
CCL19	Q99731	2	EBI-11700693,EBI-11711510
CCL2	P13500	2	EBI-11700693,EBI-11711396
CCL7	P80098	2	EBI-11700693,EBI-11711410
CXCL11	O14625	2	EBI-11700693,EBI-11711364
CXCL8	P10145	15	EBI-11700693,EBI-3917999
FN1	P02751	8	EBI-11700693,EBI-1220319
GDF5	P43026	3	EBI-11700693,EBI-11710512
PTX3	P26022	8	EBI-11700693,EBI-11574553
TNFSF11	O14788	4	EBI-11700693,EBI-7404021

Protein-protein interaction databases

BioGridⁱ	112984, 22 interactors
IntActⁱ	P98066, 25 interactors
STRINGⁱ	9606.ENSP00000243347

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	37 – 40	Combined sources	4
Beta strandⁱ	42 – 44	Combined sources	3
Beta strandⁱ	45 – 47	Combined sources	3
Helixⁱ	51 – 60	Combined sources	10
Helixⁱ	68 – 76	Combined sources	9
Beta strandⁱ	85 – 87	Combined sources	3
Helixⁱ	88 – 90	Combined sources	3
Beta strandⁱ	91 – 97	Combined sources	7
Turnⁱ	101 – 103	Combined sources	3
Beta strandⁱ	109 – 115	Combined sources	7
Beta strandⁱ	123 – 128	Combined sources	6
Beta strandⁱ	137 – 139	Combined sources	3
Beta strandⁱ	141 – 147	Combined sources	7
Turnⁱ	149 – 152	Combined sources	4
Beta strandⁱ	160 – 166	Combined sources	7
Beta strandⁱ	172 – 181	Combined sources	10
Beta strandⁱ	190 – 209	Combined sources	20
Beta strandⁱ	211 – 213	Combined sources	3
Beta strandⁱ	221 – 230	Combined sources	10
Beta strandⁱ	239 – 247	Combined sources	9

Show more details

3D structure databases

ProteinModelPortalⁱ	P98066
SMRⁱ	P98066
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P98066

EvolutionaryTraceⁱ

P98066

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	36 – 129	LinkPROSITE-ProRule annotationAdd BLAST		94
Domainⁱ	135 – 247	CUBPROSITE-ProRule annotationAdd BLAST		113

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	KOG1218 Eukaryota KOG3714 Eukaryota ENOG410ZI1H LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000119025
HOGENOMⁱ	HOG000043074
HOVERGENⁱ	HBG006669
InParanoidⁱ	P98066
KEGG Orthology (KO) More...KOⁱ	K19018
OMAⁱ	CEYEGGH
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G09EL
PhylomeDBⁱ	P98066
TreeFamⁱ	TF334173

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00041 CUB, 1 hit
Gene3Dⁱ	2.60.120.290, 1 hit 3.10.100.10, 1 hit
InterProⁱ	View protein in InterPro IPR016186 C-type_lectin-like/link_sf IPR016187 CTDL_fold IPR000859 CUB_dom IPR000538 Link_dom IPR035914 Sperma_CUB_dom_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00431 CUB, 1 hit PF00193 Xlink, 1 hit
PRINTSⁱ	PR01265 LINKMODULE
SMARTⁱ	View protein in SMART SM00042 CUB, 1 hit SM00445 LINK, 1 hit
SUPFAMⁱ	SSF49854 SSF49854, 1 hit SSF56436 SSF56436, 1 hit
PROSITEⁱ	View protein in PROSITE PS01180 CUB, 1 hit PS01241 LINK_1, 1 hit PS50963 LINK_2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P98066-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MIILIYLFLL LWEDTQGWGF KDGIFHNSIW LERAAGVYHR EARSGKYKLT 
        60         70         80         90        100
YAEAKAVCEF EGGHLATYKQ LEAARKIGFH VCAAGWMAKG RVGYPIVKPG 
       110        120        130        140        150
PNCGFGKTGI IDYGIRLNRS ERWDAYCYNP HAKECGGVFT DPKQIFKSPG 
       160        170        180        190        200
FPNEYEDNQI CYWHIRLKYG QRIHLSFLDF DLEDDPGCLA DYVEIYDSYD 
       210        220        230        240        250
DVHGFVGRYC GDELPDDIIS TGNVMTLKFL SDASVTAGGF QIKYVAMDPV 
       260        270 
SKSSQGKNTS TTSTGNKNFL AGRFSHL

Length:277

Mass (Da):31,203

Last modified:June 21, 2005 - v2

Checksum:ⁱE2B3AEB76353A782

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_013005	144	Q → R2 PublicationsCorresponds to variant dbSNP:rs1046668Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M31165 mRNA Translation: AAB00792.1 AJ421518 mRNA Translation: CAD13434.1 AJ419936 mRNA Translation: CAD12353.1 AC009311 Genomic DNA Translation: AAY15067.1 CH471058 Genomic DNA Translation: EAX11511.1 BC030205 mRNA Translation: AAH30205.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS2193.1
PIRⁱ	A41735
NCBI Reference Sequences More...RefSeqⁱ	NP_009046.2, NM_007115.3
UniGeneⁱ	Hs.437322

Genome annotation databases

Ensemblⁱ	ENST00000243347; ENSP00000243347; ENSG00000123610
GeneIDⁱ	7130
KEGGⁱ	hsa:7130
UCSC genome browser More...UCSCⁱ	uc002txk.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Protein	Similar proteins		Species	Score	Length	Source
P98066	Tumor necrosis factor-inducible gene 6 protein		RABIT		276	UniRef90_P98066
Tumor necrosis factor-inducible gene 6 protein		MOUSE		275
Uncharacterized protein		SHEEP		280
TNF alpha induced protein 6		BOVIN		280
Tumor necrosis factor-inducible 6 protein		wild yak		280
+89

Protein	Similar proteins		Species	Score	Length	Source
P98066	Tumor necrosis factor-inducible gene 6 protein		RABIT		276	UniRef50_P98066
Tumor necrosis factor-inducible gene 6 protein		MOUSE		275
Uncharacterized protein		SHEEP		280
TNF alpha induced protein 6		BOVIN		280
Tumor necrosis factor-inducible 6 protein		wild yak		280
+231

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M31165 mRNA Translation: AAB00792.1 AJ421518 mRNA Translation: CAD13434.1 AJ419936 mRNA Translation: CAD12353.1 AC009311 Genomic DNA Translation: AAY15067.1 CH471058 Genomic DNA Translation: EAX11511.1 BC030205 mRNA Translation: AAH30205.1
CCDSⁱ	CCDS2193.1
PIRⁱ	A41735
RefSeqⁱ	NP_009046.2, NM_007115.3
UniGeneⁱ	Hs.437322

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1O7B	NMR	-	T	36-133	[»]
	1O7C	NMR	-	T	36-133	[»]
	2N40	NMR	-	A	36-133	[»]
	2PF5	X-ray	1.90	A/B/C/D/E	36-133	[»]
	2WNO	X-ray	2.30	A	129-277	[»]
ProteinModelPortalⁱ	P98066
SMRⁱ	P98066
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112984, 22 interactors
IntActⁱ	P98066, 25 interactors
STRINGⁱ	9606.ENSP00000243347

Chemistry databases

DrugBankⁱ	DB08818 Hyaluronic acid

DrugBankⁱ

DB08818 Hyaluronic acid

PTM databases

iPTMnetⁱ	P98066
PhosphoSitePlusⁱ	P98066

Polymorphism and mutation databases

BioMutaⁱ	TNFAIP6
DMDMⁱ	68067717

Proteomic databases

PaxDbⁱ	P98066
PeptideAtlasⁱ	P98066
PRIDEⁱ	P98066
ProteomicsDBⁱ	57783

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	7130
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000243347; ENSP00000243347; ENSG00000123610
GeneIDⁱ	7130
KEGGⁱ	hsa:7130
UCSCⁱ	uc002txk.3 human

Organism-specific databases

CTDⁱ	7130
DisGeNETⁱ	7130
EuPathDBⁱ	HostDB:ENSG00000123610.4
GeneCardsⁱ	TNFAIP6
HGNCⁱ	HGNC:11898 TNFAIP6
HPAⁱ	CAB032719 HPA050884
MIMⁱ	600410 gene
neXtProtⁱ	NX_P98066
OpenTargetsⁱ	ENSG00000123610
PharmGKBⁱ	PA36595
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1218 Eukaryota KOG3714 Eukaryota ENOG410ZI1H LUCA
GeneTreeⁱ	ENSGT00760000119025
HOGENOMⁱ	HOG000043074
HOVERGENⁱ	HBG006669
InParanoidⁱ	P98066
KOⁱ	K19018
OMAⁱ	CEYEGGH
OrthoDBⁱ	EOG091G09EL
PhylomeDBⁱ	P98066
TreeFamⁱ	TF334173

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6798695 Neutrophil degranulation
SIGNORⁱ	P98066

Miscellaneous databases

ChiTaRSⁱ	TNFAIP6 human
EvolutionaryTraceⁱ	P98066
GeneWikiⁱ	TSG-6
GenomeRNAiⁱ	7130
Protein Ontology More...PROⁱ	PR:P98066
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000123610 Expressed in 178 organ(s), highest expression level in layer of synovial tissue
CleanExⁱ	HS_TNFAIP6
Genevisibleⁱ	P98066 HS

Family and domain databases

CDDⁱ	cd00041 CUB, 1 hit
Gene3Dⁱ	2.60.120.290, 1 hit 3.10.100.10, 1 hit
InterProⁱ	View protein in InterPro IPR016186 C-type_lectin-like/link_sf IPR016187 CTDL_fold IPR000859 CUB_dom IPR000538 Link_dom IPR035914 Sperma_CUB_dom_sf
Pfamⁱ	View protein in Pfam PF00431 CUB, 1 hit PF00193 Xlink, 1 hit
PRINTSⁱ	PR01265 LINKMODULE
SMARTⁱ	View protein in SMART SM00042 CUB, 1 hit SM00445 LINK, 1 hit
SUPFAMⁱ	SSF49854 SSF49854, 1 hit SSF56436 SSF56436, 1 hit
PROSITEⁱ	View protein in PROSITE PS01180 CUB, 1 hit PS01241 LINK_1, 1 hit PS50963 LINK_2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TSG6_HUMAN
Accessionⁱ	P98066Primary (citable) accession number: P98066 Secondary accession number(s): Q53TI7, Q8WWI9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1996
	Last sequence update:	June 21, 2005
	Last modified:	November 7, 2018
	This is version 170 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P98066 (TSG6_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Tumor necrosis factor-inducible gene 6 protein

TNFAIP6

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ