Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P97931 (UNG_MOUSE)

Entry version 160 (02 Dec 2020)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Uracil-DNA glycosylase

Gene

Ung

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.UniRule annotation EC:3.2.2.27

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei147Proton acceptorUniRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processDNA damage, DNA repair

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-110329, Cleavage of the damaged pyrimidine
R-MMU-110357, Displacement of DNA glycosylase by APEX1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uracil-DNA glycosylaseUniRule annotation (EC:3.2.2.27UniRule annotation)
Short name:
UDGUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ung
Synonyms:Ung1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:109352, Ung

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001761741 – 306Uracil-DNA glycosylaseAdd BLAST306

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei12PhosphoserineBy similarity1
Modified residuei23PhosphoserineBy similarity1
Modified residuei43PhosphoserineCombined sources1
Modified residuei57PhosphoserineBy similarity1
Modified residuei288N6-acetyllysineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Isoform 1 is processed by cleavage of a transit peptide.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P97931

PeptideAtlas

More...PeptideAtlasi		P97931

PRoteomics IDEntifications database

More...PRIDEi		P97931

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P97931

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P97931

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000029591, Expressed in primary oocyte and 263 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P97931, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

Interacts with FAM72A.

UniRule annotation

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		P97931, 1 interactor

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000031587

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P97931, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P97931

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the uracil-DNA glycosylase (UDG) superfamily. UNG family.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2994, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000003405

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032162_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P97931

Database of Orthologous Groups

More...OrthoDBi		832568at2759

TreeFam database of animal gene trees

More...TreeFami		TF315028

Family and domain databases

Conserved Domains Database

More...CDDi		cd10027, UDG_F1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.470.10, 1 hit

HAMAP database of protein families

More...HAMAPi		MF_00148, UDG, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002043, UDG_fam1
IPR018085, Ura-DNA_Glyclase_AS
IPR005122, Uracil-DNA_glycosylase-like
IPR036895, Uracil-DNA_glycosylase-like_sf

The PANTHER Classification System

More...PANTHERi		PTHR11264, PTHR11264, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03167, UDG, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00986, UDG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52141, SSF52141, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00628, ung, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00130, U_DNA_GLYCOSYLASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P97931-1) [UniParc]FASTAAdd to basket
Also known as: UNG2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIGQKTLYSF FSPTPTGKRT TRSPEPVPGS GVAAEIGGDA VASPAKKARV 
        60         70         80         90        100
EQNEQGSPLS AEQLVRIQRN KAAALLRLAA RNVPAGFGES WKQQLCGEFG 
       110        120        130        140        150
KPYFVKLMGF VAEERNHHKV YPPPEQVFTW TQMCDIRDVK VVILGQDPYH 
       160        170        180        190        200
GPNQAHGLCF SVQRPVPPPP SLENIFKELS TDIDGFVHPG HGDLSGWARQ 
       210        220        230        240        250
GVLLLNAVLT VRAHQANSHK ERGWEQFTDA VVSWLNQNLS GLVFLLWGSY 
       260        270        280        290        300
AQKKGSVIDR KRHHVLQTAH PSPLSVHRGF LGCRHFSKAN ELLQKSGKKP 

INWKEL
Length:306
Mass (Da):33,926
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCE2D5192936CE6EA
GO
Isoform 1 (identifier: P97931-2) [UniParc]FASTAAdd to basket
Also known as: UNG1

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAV → MGVLGRRSLRLARRAGLRSLTPNPDSDSRQ

Show »
Length:295
Mass (Da):33,054
Checksum:i7E66E56DEC55B851
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z1G1D3Z1G1_MOUSE
Uracil-DNA glycosylase
Ung UNG, UNG1
199Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YW18D3YW18_MOUSE
Uracil-DNA glycosylase
Ung
185Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JDS8A0A0G2JDS8_MOUSE
Uracil-DNA glycosylase
Ung
132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti277H → Y in CAA67489 (PubMed:9016624).Curated1
Sequence conflicti277H → Y in CAA70168 (PubMed:9016624).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0085141 – 41MIGQK…GGDAV → MGVLGRRSLRLARRAGLRSL TPNPDSDSRQ in isoform 1. 5 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U55040 Genomic DNA Translation: AAB39511.1
U55041 mRNA Translation: AAC53197.1
X99018 mRNA Translation: CAA67489.1
Y08975 mRNA Translation: CAA70168.1
AF174485 Genomic DNA Translation: AAF76936.1
AK146178 mRNA Translation: BAE26956.1
CH466529 Genomic DNA Translation: EDL19920.1
BC011039 mRNA Translation: AAH11039.1
BC052853 mRNA Translation: AAH52853.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS19560.1 [P97931-2]
CCDS39221.1 [P97931-1]

NCBI Reference Sequences

More...RefSeqi		NP_001035781.1, NM_001040691.1 [P97931-1]
NP_035807.2, NM_011677.2 [P97931-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000031587; ENSMUSP00000031587; ENSMUSG00000029591 [P97931-1]
ENSMUST00000102584; ENSMUSP00000099644; ENSMUSG00000029591 [P97931-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		22256

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:22256

UCSC genome browser

More...UCSCi		uc008yzf.1, mouse [P97931-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55040 Genomic DNA Translation: AAB39511.1
U55041 mRNA Translation: AAC53197.1
X99018 mRNA Translation: CAA67489.1
Y08975 mRNA Translation: CAA70168.1
AF174485 Genomic DNA Translation: AAF76936.1
AK146178 mRNA Translation: BAE26956.1
CH466529 Genomic DNA Translation: EDL19920.1
BC011039 mRNA Translation: AAH11039.1
BC052853 mRNA Translation: AAH52853.1
CCDSiCCDS19560.1 [P97931-2]
CCDS39221.1 [P97931-1]
RefSeqiNP_001035781.1, NM_001040691.1 [P97931-1]
NP_035807.2, NM_011677.2 [P97931-2]

3D structure databases

SMRiP97931
ModBaseiSearch...

Protein-protein interaction databases

IntActiP97931, 1 interactor
STRINGi10090.ENSMUSP00000031587

PTM databases

iPTMnetiP97931
PhosphoSitePlusiP97931

Proteomic databases

PaxDbiP97931
PeptideAtlasiP97931
PRIDEiP97931

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3173, 507 antibodies

Genome annotation databases

EnsembliENSMUST00000031587; ENSMUSP00000031587; ENSMUSG00000029591 [P97931-1]
ENSMUST00000102584; ENSMUSP00000099644; ENSMUSG00000029591 [P97931-2]
GeneIDi22256
KEGGimmu:22256
UCSCiuc008yzf.1, mouse [P97931-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7374
MGIiMGI:109352, Ung

Phylogenomic databases

eggNOGiKOG2994, Eukaryota
GeneTreeiENSGT00390000003405
HOGENOMiCLU_032162_2_1_1
InParanoidiP97931
OrthoDBi832568at2759
TreeFamiTF315028

Enzyme and pathway databases

ReactomeiR-MMU-110329, Cleavage of the damaged pyrimidine
R-MMU-110357, Displacement of DNA glycosylase by APEX1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		22256, 1 hit in 17 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Ung, mouse

Protein Ontology

More...PROi		PR:P97931
RNActiP97931, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000029591, Expressed in primary oocyte and 263 other tissues
GenevisibleiP97931, MM

Family and domain databases

CDDicd10027, UDG_F1, 1 hit
Gene3Di3.40.470.10, 1 hit
HAMAPiMF_00148, UDG, 1 hit
InterProiView protein in InterPro
IPR002043, UDG_fam1
IPR018085, Ura-DNA_Glyclase_AS
IPR005122, Uracil-DNA_glycosylase-like
IPR036895, Uracil-DNA_glycosylase-like_sf
PANTHERiPTHR11264, PTHR11264, 1 hit
PfamiView protein in Pfam
PF03167, UDG, 1 hit
SMARTiView protein in SMART
SM00986, UDG, 1 hit
SUPFAMiSSF52141, SSF52141, 1 hit
TIGRFAMsiTIGR00628, ung, 1 hit
PROSITEiView protein in PROSITE
PS00130, U_DNA_GLYCOSYLASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUNG_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P97931
Secondary accession number(s): P97285
, P97509, Q7TPW8, Q9JIW8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: December 2, 2020
This is version 160 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again