Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

85/88 kDa calcium-independent phospholipase A2

Gene

Pla2g6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods (By similarity).By similarity

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Activity regulationi

Inhibited by calcium-activated calmodulin.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei520NucleophilePROSITE-ProRule annotation1
Active sitei653Proton acceptorPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
Biological processChemotaxis, Lipid degradation, Lipid metabolism

Enzyme and pathway databases

ReactomeiR-MMU-1482788 Acyl chain remodelling of PC
R-MMU-1482839 Acyl chain remodelling of PE
R-MMU-2029485 Role of phospholipids in phagocytosis
R-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

Names & Taxonomyi

Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
Gene namesi
Name:Pla2g6
Synonyms:Pnpla9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1859152 Pla2g6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3259503

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000670381 – 80785/88 kDa calcium-independent phospholipase A2Add BLAST807

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP97819
PaxDbiP97819
PeptideAtlasiP97819
PRIDEiP97819

PTM databases

iPTMnetiP97819
PhosphoSitePlusiP97819

Expressioni

Gene expression databases

BgeeiENSMUSG00000042632 Expressed in 270 organ(s), highest expression level in testis
CleanExiMM_PLA2G6
ExpressionAtlasiP97819 baseline and differential
GenevisibleiP97819 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

IntActiP97819, 3 interactors
STRINGi10090.ENSMUSP00000134672

Structurei

3D structure databases

ProteinModelPortaliP97819
SMRiP97819
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati151 – 181ANK 1Add BLAST31
Repeati185 – 215ANK 2Add BLAST31
Repeati219 – 248ANK 3Add BLAST30
Repeati251 – 281ANK 4Add BLAST31
Repeati286 – 312ANK 5Add BLAST27
Repeati316 – 345ANK 6Add BLAST30
Repeati349 – 378ANK 7Add BLAST30
Domaini482 – 666PNPLAPROSITE-ProRule annotationAdd BLAST185

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni678 – 697Calmodulin-bindingBy similarityAdd BLAST20
Regioni749 – 760Calmodulin-bindingBy similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi486 – 491GXGXXGPROSITE-ProRule annotation6
Motifi518 – 522GXSXGPROSITE-ProRule annotation5
Motifi653 – 655DGA/GPROSITE-ProRule annotation3

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0513 Eukaryota
COG0666 LUCA
COG3621 LUCA
GeneTreeiENSGT00530000063645
HOGENOMiHOG000013092
HOVERGENiHBG053482
InParanoidiP97819
KOiK16343
OMAiRARSWCH
OrthoDBiEOG091G042U
TreeFamiTF319230

Family and domain databases

CDDicd00204 ANK, 2 hits
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR002641 PNPLA_dom
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF01734 Patatin, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52151 SSF52151, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits
PS51635 PNPLA, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform Long (identifier: P97819-1) [UniParc]FASTAAdd to basket
Also known as: iPLA2-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQFFGRLVNT LSSVTNLFSN PFRVKEVSLT DYVSSERVRE EGQLILLQNV
60 70 80 90 100
SNRTWDCVLV SPRNPQSGFR LFQLESEADA LVNFQQFSSQ LPPFYESSVQ
110 120 130 140 150
VLHVEVLQHL TDLIRNHPSW TVTHLAVELG IRECFHHSRI ISCANSTENE
160 170 180 190 200
EGCTPLHLAC RKGDSEILVE LVQYCHAQMD VTDNKGETAF HYAVQGDNPQ
210 220 230 240 250
VLQLLGKNAS AGLNQVNNQG LTPLHLACKM GKQEMVRVLL LCNARCNIMG
260 270 280 290 300
PGGFPIHTAM KFSQKGCAEM IISMDSNQIH SKDPRYGASP LHWAKNAEMA
310 320 330 340 350
RMLLKRGCDV DSTSSSGNTA LHVAVMRNRF DCVMVLLTYG ANAGARGEHG
360 370 380 390 400
NTPLHLAMSK DNMEMVKALI VFGAEVDTPN DFGETPALIA SKISKLITRK
410 420 430 440 450
ALLTLLKTVG ADHHFPIIQG VSTEQGSAAA THPLFSLDRT QPPAISLNNL
460 470 480 490 500
ELQDLMPISR ARKPAFILSS MRDEKRSHDH LLCLDGGGVK GLVIIQLLIA
510 520 530 540 550
IEKASGVATK DLFDWVAGTS TGGILALAIL HSKSMAYMRG VYFRMKDEVF
560 570 580 590 600
RGSRPYESGP LEEFLKREFG EHTKMTDVKK PKVMLTGTLS DRQPAELHLF
610 620 630 640 650
RNYDAPEAVR EPRCNQNINL KPPTQPADQL VWRAARSSGA APTYFRPNGR
660 670 680 690 700
FLDGGLLANN PTLDAMTEIH EYNQDMIRKG QGNKVKKLSI VVSLGTGKSP
710 720 730 740 750
QVPVTCVDVF RPSNPWELAK TVFGAKELGK MVVDCCTDPD GRAVDRARAW
760 770 780 790 800
CEMVGIQYFR LNPQLGSDIM LDEVSDAVLV NALWETEVYI YEHREEFQKL

VQLLLSP
Length:807
Mass (Da):89,560
Last modified:October 31, 2012 - v3
Checksum:i3838889731100294
GO
Isoform Short (identifier: P97819-2) [UniParc]FASTAAdd to basket
Also known as: iPLA2-S

The sequence of this isoform differs from the canonical sequence as follows:
     396-451: LITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNLE → Q

Show »
Length:752
Mass (Da):83,702
Checksum:iAAC3347B0E1292E9
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3UX52G3UX52_MOUSE
85/88 kDa calcium-independent phosp...
Pla2g6
199Annotation score:
G3UY97G3UY97_MOUSE
85/88 kDa calcium-independent phosp...
Pla2g6
204Annotation score:
G3UX73G3UX73_MOUSE
85/88 kDa calcium-independent phosp...
Pla2g6
33Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044364396 – 451LITRK…LNNLE → Q in isoform Short. 2 PublicationsAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88624 mRNA Translation: AAB48511.2
AF259401 mRNA Translation: AAF72651.1
BC003487 mRNA Translation: AAH03487.1
BC057209 mRNA Translation: AAH57209.1
CCDSiCCDS27637.1 [P97819-2]
CCDS56991.1 [P97819-1]
RefSeqiNP_001185952.1, NM_001199023.1 [P97819-1]
NP_001185953.1, NM_001199024.1 [P97819-2]
NP_001185954.1, NM_001199025.1 [P97819-2]
NP_058611.1, NM_016915.4 [P97819-2]
XP_006521215.1, XM_006521152.2 [P97819-1]
XP_006521216.1, XM_006521153.3 [P97819-1]
XP_006521217.1, XM_006521154.1 [P97819-1]
XP_006521218.1, XM_006521155.2 [P97819-1]
XP_006521219.1, XM_006521156.3 [P97819-1]
XP_006521220.1, XM_006521157.3 [P97819-1]
XP_006521221.1, XM_006521158.2 [P97819-1]
XP_006521222.1, XM_006521159.3 [P97819-1]
XP_006521223.1, XM_006521160.2 [P97819-1]
XP_017172187.1, XM_017316698.1 [P97819-2]
UniGeneiMm.155620

Genome annotation databases

EnsembliENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632 [P97819-2]
ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632 [P97819-2]
ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632 [P97819-2]
ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632 [P97819-2]
ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632 [P97819-1]
GeneIDi53357
KEGGimmu:53357
UCSCiuc007wtd.2 mouse [P97819-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88624 mRNA Translation: AAB48511.2
AF259401 mRNA Translation: AAF72651.1
BC003487 mRNA Translation: AAH03487.1
BC057209 mRNA Translation: AAH57209.1
CCDSiCCDS27637.1 [P97819-2]
CCDS56991.1 [P97819-1]
RefSeqiNP_001185952.1, NM_001199023.1 [P97819-1]
NP_001185953.1, NM_001199024.1 [P97819-2]
NP_001185954.1, NM_001199025.1 [P97819-2]
NP_058611.1, NM_016915.4 [P97819-2]
XP_006521215.1, XM_006521152.2 [P97819-1]
XP_006521216.1, XM_006521153.3 [P97819-1]
XP_006521217.1, XM_006521154.1 [P97819-1]
XP_006521218.1, XM_006521155.2 [P97819-1]
XP_006521219.1, XM_006521156.3 [P97819-1]
XP_006521220.1, XM_006521157.3 [P97819-1]
XP_006521221.1, XM_006521158.2 [P97819-1]
XP_006521222.1, XM_006521159.3 [P97819-1]
XP_006521223.1, XM_006521160.2 [P97819-1]
XP_017172187.1, XM_017316698.1 [P97819-2]
UniGeneiMm.155620

3D structure databases

ProteinModelPortaliP97819
SMRiP97819
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP97819, 3 interactors
STRINGi10090.ENSMUSP00000134672

Chemistry databases

ChEMBLiCHEMBL3259503

PTM databases

iPTMnetiP97819
PhosphoSitePlusiP97819

Proteomic databases

MaxQBiP97819
PaxDbiP97819
PeptideAtlasiP97819
PRIDEiP97819

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632 [P97819-2]
ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632 [P97819-2]
ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632 [P97819-2]
ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632 [P97819-2]
ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632 [P97819-1]
GeneIDi53357
KEGGimmu:53357
UCSCiuc007wtd.2 mouse [P97819-1]

Organism-specific databases

CTDi8398
MGIiMGI:1859152 Pla2g6

Phylogenomic databases

eggNOGiKOG0513 Eukaryota
COG0666 LUCA
COG3621 LUCA
GeneTreeiENSGT00530000063645
HOGENOMiHOG000013092
HOVERGENiHBG053482
InParanoidiP97819
KOiK16343
OMAiRARSWCH
OrthoDBiEOG091G042U
TreeFamiTF319230

Enzyme and pathway databases

ReactomeiR-MMU-1482788 Acyl chain remodelling of PC
R-MMU-1482839 Acyl chain remodelling of PE
R-MMU-2029485 Role of phospholipids in phagocytosis
R-MMU-6811436 COPI-independent Golgi-to-ER retrograde traffic

Miscellaneous databases

PROiPR:P97819
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042632 Expressed in 270 organ(s), highest expression level in testis
CleanExiMM_PLA2G6
ExpressionAtlasiP97819 baseline and differential
GenevisibleiP97819 MM

Family and domain databases

CDDicd00204 ANK, 2 hits
Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR016035 Acyl_Trfase/lysoPLipase
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR002641 PNPLA_dom
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF01734 Patatin, 1 hit
PRINTSiPR01415 ANKYRIN
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF52151 SSF52151, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits
PS51635 PNPLA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPLPL9_MOUSE
AccessioniPrimary (citable) accession number: P97819
Secondary accession number(s): Q99LA9, Q9JK61
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 31, 2012
Last modified: November 7, 2018
This is version 157 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again