Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone-lysine N-methyltransferase Smyd1

Gene

Smyd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Methylates histone H3 at 'Lys-4' (H3K4me). Acts as a transcriptional repressor. Essential for cardiomyocyte differentiation and cardiac morphogenesis.2 Publications

Catalytic activityi

S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N6-methyl-L-lysine-[histone].1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei135S-adenosyl-L-methionine1
Metal bindingi208Zinc1
Metal bindingi274Zinc1
Metal bindingi276Zinc1
Metal bindingi279Zinc1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri52 – 90MYND-typePROSITE-ProRule annotationAdd BLAST39

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Methyltransferase, Repressor, Transferase
Biological processTranscription, Transcription regulation
LigandMetal-binding, S-adenosyl-L-methionine, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Histone-lysine N-methyltransferase Smyd1 (EC:2.1.1.43)
Alternative name(s):
CD8b-opposite
SET and MYND domain-containing protein 1
Zinc finger protein BOP
Short name:
m-BOP
Gene namesi
Name:Smyd1
Synonyms:Bop
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:104790 Smyd1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002183081 – 490Histone-lysine N-methyltransferase Smyd1Add BLAST490

Proteomic databases

MaxQBiP97443
PaxDbiP97443
PRIDEiP97443

PTM databases

iPTMnetiP97443
PhosphoSitePlusiP97443

Expressioni

Tissue specificityi

Expressed in cardiac and skeletal muscle, lymphocytes and thymus.2 Publications

Gene expression databases

BgeeiENSMUSG00000055027 Expressed in 198 organ(s), highest expression level in skeletal muscle tissue
CleanExiMM_SMYD1
ExpressionAtlasiP97443 baseline and differential
GenevisibleiP97443 MM

Interactioni

Subunit structurei

Interacts with HDAC1, HDAC2 and HDAC3. Interacts (via MYND-type zinc finger) with NACA isoform skNAC.2 Publications

Protein-protein interaction databases

BioGridi198379, 5 interactors
ELMiP97443
IntActiP97443, 2 interactors
MINTiP97443
STRINGi10090.ENSMUSP00000073911

Structurei

Secondary structure

1490
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP97443
SMRiP97443
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP97443

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini7 – 253SETPROSITE-ProRule annotationAdd BLAST247

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni17 – 19S-adenosyl-L-methionine binding3
Regioni205 – 206S-adenosyl-L-methionine binding2
Regioni270 – 272S-adenosyl-L-methionine bindingBy similarity3

Domaini

The SET domain is split between the S-sequence (residues 1-49) and the core SET domain (residues 181-258), however the two segments still come together to form a conserved SET domain fold.

Sequence similaritiesi

Belongs to the class V-like SAM-binding methyltransferase superfamily.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri52 – 90MYND-typePROSITE-ProRule annotationAdd BLAST39

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG2084 Eukaryota
COG2940 LUCA
GeneTreeiENSGT00530000063077
HOGENOMiHOG000050244
HOVERGENiHBG054953
InParanoidiP97443
KOiK11426
OMAiVTHGPTH
OrthoDBiEOG091G066T
PhylomeDBiP97443
TreeFamiTF106487

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR001214 SET_dom
IPR011990 TPR-like_helical_dom_sf
IPR002893 Znf_MYND
PfamiView protein in Pfam
PF00856 SET, 1 hit
PF01753 zf-MYND, 1 hit
SMARTiView protein in SMART
SM00317 SET, 1 hit
PROSITEiView protein in PROSITE
PS50280 SET, 1 hit
PS01360 ZF_MYND_1, 1 hit
PS50865 ZF_MYND_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P97443-1) [UniParc]FASTAAdd to basket
Also known as: ISKM-BOP11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTIGSMENVE VFTSEGKGRG LKATKEFWAA DVIFAERAYS AVVFDSLINF
60 70 80 90 100
VCHTCFKRQE KLHRCGQCKF AHYCDRTCQK DAWLNHKNEC AAIKKYGKVP
110 120 130 140 150
NENIRLAARI MWRVEREGTG LTEGCLVSVD DLQNHVEHFG EEEQKELRVD
160 170 180 190 200
VDTFLQYWPP QSQQFSMQYI SHIFGVINCN GFTLSDQRGL QAVGVGIFPN
210 220 230 240 250
LGLVNHDCWP NCTVIFNNGN HEAVKSMFHT QMRIELRALG KISEGEELTV
260 270 280 290 300
SYIDFLHLSE ERRRQLKKQY YFDCSCEHCQ KGLKDDLFLA AKEDPKPSQE
310 320 330 340 350
VVKEMIQFSK DTLEKIDKAR SEGLYHEVVK LCRECLEKQE PVFADTNLYV
360 370 380 390 400
LRLLSIASEV LSYLQAYEEA SHYARRMVDG YMKLYHHNNA QLGMAVMRAG
410 420 430 440 450
LTNWHAGHIE VGHGMICKAY AILLVTHGPS HPITKDLEAM RMQTEMELRM
460 470 480 490
FRQNEFMYHK MREAALNNQP MQVMAEPSNE PAPALFHKKQ
Length:490
Mass (Da):56,496
Last modified:May 3, 2011 - v3
Checksum:i5D18208678771CBE
GO
Isoform 2 (identifier: P97443-2) [UniParc]FASTAAdd to basket
Also known as: SKM-BOP21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     220-220: N → K
     221-233: Missing.

Show »
Length:477
Mass (Da):54,926
Checksum:iA927C87FA4B6CAC7
GO
Isoform 3 (identifier: P97443-3) [UniParc]FASTAAdd to basket
Also known as: T-BOP1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     6-45: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFD → MKNGEACGGWQ

Show »
Length:461
Mass (Da):53,206
Checksum:i782D59F2992BBA22
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E8R7G5E8R7_MOUSE
Histone-lysine N-methyltransferase ...
Smyd1
456Annotation score:
G3UZ94G3UZ94_MOUSE
Histone-lysine N-methyltransferase ...
Smyd1
58Annotation score:
Q8BMV4Q8BMV4_MOUSE
Histone-lysine N-methyltransferase ...
Smyd1
69Annotation score:
G3UXZ0G3UXZ0_MOUSE
Histone-lysine N-methyltransferase ...
Smyd1
21Annotation score:

Sequence cautioni

The sequence AAC53021 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAC53022 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti95K → R in strain: C57BL/6. 1 Publication1
Natural varianti160P → L in strain: C57BL/6. 1 Publication1
Natural varianti344A → T in strain: C57BL/6. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0504026 – 45MENVE…AVVFD → MKNGEACGGWQ in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_050403220N → K in isoform 2. 1 Publication1
Alternative sequenceiVSP_050404221 – 233Missing in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U76371 mRNA Translation: AAC53020.1
U76373 mRNA Translation: AAC53021.2 Different initiation.
U76374 mRNA Translation: AAC53022.2 Different initiation.
AK142252 mRNA Translation: BAE24995.1
CH466523 Genomic DNA Translation: EDK98934.1
BC076601 mRNA Translation: AAH76601.1
CCDSiCCDS20227.2 [P97443-2]
CCDS51805.1 [P97443-1]
RefSeqiNP_001153599.1, NM_001160127.1 [P97443-1]
NP_033892.2, NM_009762.2 [P97443-2]
UniGeneiMm.234274
Mm.440892

Genome annotation databases

EnsembliENSMUST00000074301; ENSMUSP00000073911; ENSMUSG00000055027 [P97443-1]
ENSMUST00000114186; ENSMUSP00000109824; ENSMUSG00000055027 [P97443-2]
GeneIDi12180
KEGGimmu:12180
UCSCiuc009cgj.2 mouse [P97443-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U76371 mRNA Translation: AAC53020.1
U76373 mRNA Translation: AAC53021.2 Different initiation.
U76374 mRNA Translation: AAC53022.2 Different initiation.
AK142252 mRNA Translation: BAE24995.1
CH466523 Genomic DNA Translation: EDK98934.1
BC076601 mRNA Translation: AAH76601.1
CCDSiCCDS20227.2 [P97443-2]
CCDS51805.1 [P97443-1]
RefSeqiNP_001153599.1, NM_001160127.1 [P97443-1]
NP_033892.2, NM_009762.2 [P97443-2]
UniGeneiMm.234274
Mm.440892

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3N71X-ray2.30A1-490[»]
ProteinModelPortaliP97443
SMRiP97443
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198379, 5 interactors
ELMiP97443
IntActiP97443, 2 interactors
MINTiP97443
STRINGi10090.ENSMUSP00000073911

PTM databases

iPTMnetiP97443
PhosphoSitePlusiP97443

Proteomic databases

MaxQBiP97443
PaxDbiP97443
PRIDEiP97443

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000074301; ENSMUSP00000073911; ENSMUSG00000055027 [P97443-1]
ENSMUST00000114186; ENSMUSP00000109824; ENSMUSG00000055027 [P97443-2]
GeneIDi12180
KEGGimmu:12180
UCSCiuc009cgj.2 mouse [P97443-1]

Organism-specific databases

CTDi150572
MGIiMGI:104790 Smyd1

Phylogenomic databases

eggNOGiKOG2084 Eukaryota
COG2940 LUCA
GeneTreeiENSGT00530000063077
HOGENOMiHOG000050244
HOVERGENiHBG054953
InParanoidiP97443
KOiK11426
OMAiVTHGPTH
OrthoDBiEOG091G066T
PhylomeDBiP97443
TreeFamiTF106487

Miscellaneous databases

ChiTaRSiSmyd1 mouse
EvolutionaryTraceiP97443
PROiPR:P97443
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000055027 Expressed in 198 organ(s), highest expression level in skeletal muscle tissue
CleanExiMM_SMYD1
ExpressionAtlasiP97443 baseline and differential
GenevisibleiP97443 MM

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR001214 SET_dom
IPR011990 TPR-like_helical_dom_sf
IPR002893 Znf_MYND
PfamiView protein in Pfam
PF00856 SET, 1 hit
PF01753 zf-MYND, 1 hit
SMARTiView protein in SMART
SM00317 SET, 1 hit
PROSITEiView protein in PROSITE
PS50280 SET, 1 hit
PS01360 ZF_MYND_1, 1 hit
PS50865 ZF_MYND_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSMYD1_MOUSE
AccessioniPrimary (citable) accession number: P97443
Secondary accession number(s): P97442, P97444, Q6DFW7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: May 3, 2011
Last modified: September 12, 2018
This is version 132 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again