Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (18 Sep 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lysosomal-trafficking regulator

Gene

Lyst

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lysosomal-trafficking regulator
Alternative name(s):
Beige protein
CHS1 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Lyst
Synonyms:Bg, Chs1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:107448 Lyst

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Lyst are the cause of beige, an autosomal recessive disorder characterized by hypopigmentation, bleeding, immune cell dysfunction, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types.

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000510721 – 3788Lysosomal-trafficking regulatorAdd BLAST3788

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei164PhosphoserineCombined sources1
Modified residuei165PhosphothreonineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei1503PhosphoserineCombined sources1
Modified residuei1504PhosphoserineCombined sources1
Modified residuei2099PhosphoserineCombined sources1
Modified residuei2118PhosphoserineCombined sources1
Modified residuei2203PhosphoserineCombined sources1
Modified residuei2207PhosphoserineCombined sources1
Modified residuei2254PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P97412

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P97412

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P97412

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P97412

PeptideAtlas

More...
PeptideAtlasi
P97412

PRoteomics IDEntifications database

More...
PRIDEi
P97412

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P97412

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P97412

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P97412

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CENPJ, LIP8 and ZNF521.

By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
P97412, 1 interactor

Molecular INTeraction database

More...
MINTi
P97412

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106188

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P97412

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati662 – 700WD 1Add BLAST39
Repeati1576 – 1620WD 2Add BLAST45
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2996 – 3102BEACH-type PHPROSITE-ProRule annotationAdd BLAST107
Domaini3126 – 3409BEACHPROSITE-ProRule annotationAdd BLAST284
Repeati3550 – 3589WD 3Add BLAST40
Repeati3601 – 3640WD 4Add BLAST40
Repeati3643 – 3686WD 5Add BLAST44
Repeati3687 – 3731WD 6Add BLAST45
Repeati3736 – 3775WD 7Add BLAST40

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1786 Eukaryota
ENOG410XNQC LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113425

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P97412

KEGG Orthology (KO)

More...
KOi
K22937

Database of Orthologous Groups

More...
OrthoDBi
101142at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P97412

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06071 Beach, 1 hit
cd01201 PH_BEACH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1540.10, 1 hit
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR000409 BEACH_dom
IPR036372 BEACH_dom_sf
IPR030464 LYST
IPR023362 PH-BEACH_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR13743:SF86 PTHR13743:SF86, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02138 Beach, 1 hit
PF14844 PH_BEACH, 1 hit
PF00400 WD40, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01026 Beach, 1 hit
SM00320 WD40, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit
SSF50978 SSF50978, 1 hit
SSF81837 SSF81837, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50197 BEACH, 1 hit
PS51783 PH_BEACH, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P97412-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTDSNSLAR EFLIDVNQLC NAVVQRAEAR EEEEEETHMA TLGQYLVHGR
60 70 80 90 100
GFLLLTKLNS IIDQALTCRE ELLTLLLSLL PLVWKIPVQE QQATDFNLPL
110 120 130 140 150
SSDIILTKEK NSSLQKSTQG KLYLEGSAPS GQVSAKVNLF RKIRRQRKST
160 170 180 190 200
HRYSVRDARK TQLSTSDSEG NSDEKSTVVS KHRRLHALPR FLTQSPKEGH
210 220 230 240 250
LVAKPDPSAT KEQVLSDTMS VENSREVILR QDSNGDILSE PAALSILSNM
260 270 280 290 300
NNSPFDLCHV LLSLLEKVCK FDIALNHNSS LALSVVPTLT EFLAGFGDCC
310 320 330 340 350
NQSDTLEGQL VSAGWTEEPV ALVQRMLFRT VLHLMSVDVS TAEAMPESLR
360 370 380 390 400
KNLTELLRAA LKIRACLEKQ PEPFSPRQKK TLQEVQEGFV FSKYRHRALL
410 420 430 440 450
LPELLEGVLQ LLISCLQSAA SNPFYFSQAM DLVQEFIQHQ GFNLFGTAVL
460 470 480 490 500
QMEWLLTRDG VPSEAAEHLK ALINSVIKIM STVKKVKSEQ LHHSMCTRKR
510 520 530 540 550
HRRCEYSHFM QHHRDLSGLL VSAFKNQLSK SPFEETAEGD VQYPERCCCI
560 570 580 590 600
AVCAHQCLRL LQQVSLSTTC VQILSGVHSV GICCCMDPKS VIAPLLHAFK
610 620 630 640 650
LPALKAFQQH ILNVLSKLLV DQLGGAELSP RIKKAACNIC TVDSDQLAKL
660 670 680 690 700
GETLQGTLCG AGPTSGLPSP SYRFQGILPS SGSEDLLWKW DALEAYQSFV
710 720 730 740 750
FQEDRLHNIQ IANHICNLLQ KGNVVVQWKL YNYIFNPVLQ RGVELVHHCQ
760 770 780 790 800
QLSIPSAQTH MCSQLKQYLP QEVLQIYLKT LPVLLKSRVI RDLFLSCNGV
810 820 830 840 850
NHIIELNYLD GIRSHSLKAF ETLIVSLGEQ QKDAAVLDVD GLDIQQELPS
860 870 880 890 900
LSVGPSLHKQ QASSDSPCSL RKFYASLREP DPKKRKTIHQ DVHINTINLF
910 920 930 940 950
LCVAFLCVSK EADSDRESAN ESEDTSGYDS PPSEPLSHML PCLSLEDVVL
960 970 980 990 1000
PSPECLHHAA DIWSMCRWIY MLNSVFQKQF HRLGGFQVCH ELIFMIIQKL
1010 1020 1030 1040 1050
FRSHTEDQGR RQGEMSRNEN QELIRISYPE LTLKGDVSSA TAPDLGFLRK
1060 1070 1080 1090 1100
SADSVRGFQS QPVLPTSAEQ IVATESVPGE RKAFMSQQSE TSLQSIRLLE
1110 1120 1130 1140 1150
SLLDICLHSA RACQQKMELE LPSQGLSVEN ILCELREHLS QSKVAETELA
1160 1170 1180 1190 1200
KPLFDALLRV ALGNHSADLG PGDAVTEKSH PSEEELLSQP GDFSEEAEDS
1210 1220 1230 1240 1250
QCCSLKLLGE EEGYEADSES NPEDVDTQDD GVELNPEAEG FSGSIVSNNL
1260 1270 1280 1290 1300
LENLTHGEII YPEICMLGLN LLSASKAKLD VLAHVFESFL KIVRQKEKNI
1310 1320 1330 1340 1350
SLLIQQGTVK ILLGGFLNIL TQTNSDFQAC QRVLVDLLVS LMSSRTCSED
1360 1370 1380 1390 1400
LTLLWRIFLE KSPCTEILLL GIHKIVESDF TMSPSQCLTF PFLHTPSLSN
1410 1420 1430 1440 1450
GVLSQKPPGI LNSKALGLLR RARISRGKKE ADRESFPYRL LSSWHIAPIH
1460 1470 1480 1490 1500
LPLLGQNCWP HLSEGFSVSL VGLMWNTSNE SESAAERGKR VKKRNKPSVL
1510 1520 1530 1540 1550
EDSSFEGAEG DRPEVTESIN PGDRLIEDGC IHLISLGSKA LMIQVWADPH
1560 1570 1580 1590 1600
SGTFIFRVCM DSNDDTKAVS LAQVESQENI FFPSKWQHLV LTYIQHPQGK
1610 1620 1630 1640 1650
KNVHGEISIW VSGQRKTDVI LDFVLPRKTS LSSDSNKTFC MIGHCLTSQE
1660 1670 1680 1690 1700
ESLQLAGKWD LGNLLLFNGA KIGSQEAFFL YACGPNYTSI MPCKYGQPVI
1710 1720 1730 1740 1750
DYSKYINKDI LRCDEIRDLF MTKKEVDVGL LIESLSVVYT TCCPAQYTIY
1760 1770 1780 1790 1800
EPVIRLKGQV KTQPSQRPFS SKEAQSILLE PSQLKGLQPT ECKAIQGILH
1810 1820 1830 1840 1850
EIGGAGTFVF LFARVVELSS CEETQALALR VILSLIKYSQ QRTQELENCN
1860 1870 1880 1890 1900
GLSMIHQVLV KQKCIVGFHI LKTLLEGCCG EEVIHVSEHG EFKLDVESHA
1910 1920 1930 1940 1950
IIQDVKLLQE LLLDWKIWNK AEQGVWETLL AALEVLIRVE HHQQQFNIKQ
1960 1970 1980 1990 2000
LLNAHVVHHF LLTCQVLQEH REGQLTSMPR EVCRSFVKII AEVLGSPPDL
2010 2020 2030 2040 2050
ELLTVIFNFL LAVHPPTNTY VCHNPTNFYF SLHIDGKIFQ EKVQSLAYLR
2060 2070 2080 2090 2100
HSSSGGQAFP SPGFLVISPS AFTAAPPEGT SSSNIVPQRM AAQMVRSRSL
2110 2120 2130 2140 2150
PAFPTYLPLI RAQKLAASLG FSVDKLQNIA DANPEKQNLL GRPYALKTSK
2160 2170 2180 2190 2200
EEAFISSCES AKTVCEMEAL LGAHASANGV SRGSPRFPRA RVDHKDVGTE
2210 2220 2230 2240 2250
PRSDDDSPGD ESYPRRPDNL KGLASFQRSQ STVASLGLAF PSQNGSAVAS
2260 2270 2280 2290 2300
RWPSLVDRNA DDWENFTFSP AYEASYNRAT STHSVIEDCL IPICCGLYEL
2310 2320 2330 2340 2350
LSGVLLVLPD AMLEDVMDRI IQADILLVLV NHPSPAIQQG VIKLLHAYIN
2360 2370 2380 2390 2400
RASKEQKDKF LKNRGFSLLA NQLYLHRGTQ ELLECFVEMF FGRPIGLDEE
2410 2420 2430 2440 2450
FDLEEVKHME LFQKWSVIPV LGLIETSLYD NVLLHNALLL LLQVLNSCSK
2460 2470 2480 2490 2500
VADMLLDNGL LYVLCNTVAA LNGLEKNIPV NEYKLLACDI QQLFIAVTIH
2510 2520 2530 2540 2550
ACSSSGTQYF RVIEDLIVLL GYLHNSKNKR TQNMALALQL RVLQAALEFI
2560 2570 2580 2590 2600
RSTANHDSES PVHSPSAHRH SVPPKRRSIA GSRKFPLAQT ESLLMKMRSV
2610 2620 2630 2640 2650
ASDELHSMMQ RRMSQEHPSQ ASEAELAQRL QRLTILAVNR IIYQELNSDI
2660 2670 2680 2690 2700
IDILRTPENT SQSKTSVSQT EISEEDMHHE QPSVYNPFQK EMLTYLLDGF
2710 2720 2730 2740 2750
KVCIGSSKTS VSKQQWTKIL GSCKETLRDQ LGRLLAHILS PTHTVQERKQ
2760 2770 2780 2790 2800
ILEIVHEPAH QDILRDCLSP SPQHGAKLVL YLSELIHNHQ DELSEEEMDT
2810 2820 2830 2840 2850
AELLMNALKL CGHKCIPPSA PSKPELIKII REEQKKYESE ESVSKGSWQK
2860 2870 2880 2890 2900
TVNNNQQSLF QRLDFKSKDI SKIAADITQA VSLSQGIERK KVIQHIRGMY
2910 2920 2930 2940 2950
KVDLSASRHW QECIQQLTHD RAVWYDPIYY PTSWQLDPTE GPNRERRRLQ
2960 2970 2980 2990 3000
RCYLTIPNKY LLRDRQKSEG VLRPPLSYLF EDKTHSSFSS TVKDKAASES
3010 3020 3030 3040 3050
IRVNRRCISV APSRETAGEL LLGKCGMYFV EDNASDAVES SSLQGELEPA
3060 3070 3080 3090 3100
SFSWTYEEIK EVHRRWWQLR DNAVEIFLTN GRTLLLAFDN NKVRDDVYQS
3110 3120 3130 3140 3150
ILTNNLPNLL EYGNITALTN LWYSGQITNF EYLTHLNKHA GRSFNDLMQY
3160 3170 3180 3190 3200
PVFPFILSDY VSETLDLNDP SIYRNLSKPI AVQYKEKEDR YVDTYKYLEE
3210 3220 3230 3240 3250
EYRKGAREDD PMPPVQPYHY GSHYSNSGTV LHFLVRMPPF TKMFLAYQDQ
3260 3270 3280 3290 3300
SFDIPDRTFH STNTTWRLSS FESMTDVKEL IPEFFYLPEF LVNREGFDFG
3310 3320 3330 3340 3350
VRQNGERVNH VNLPPWARND PRLFILIHRQ ALESDHVSQN ICHWIDLVFG
3360 3370 3380 3390 3400
YKQKGKASVQ AINVFHPATY FGMDVSAVED PVQRRALETM IKTYGQTPRQ
3410 3420 3430 3440 3450
LFHTAHASRP GAKLNIEGEL PAAVGLLVQF AFRETREPVK EVTHPSPLSW
3460 3470 3480 3490 3500
IKGLKWGEYV GSPSAPVPVV CFSQPHGERF GSLQALPTRA ICGLSRNFCL
3510 3520 3530 3540 3550
LMTYNKEQGV RSMNNTNIQW SAILSWGYAD NILRLKSKQS EPPINFIQSS
3560 3570 3580 3590 3600
QQHQVTSCAW VPDSCQLFTG SKCGVITAYT NRLTSSTPSE IEMESQMHLY
3610 3620 3630 3640 3650
GHTEEITGLC VCKPYSVMIS VSRDGTCIVW DLNRLCYVQS LAGHKSPVTA
3660 3670 3680 3690 3700
VSASETSGDI ATVCDSAGGG SDLRLWTVNG DLVGHVHCRE IICSVAFSNQ
3710 3720 3730 3740 3750
PEGVSINVIA GGLENGIVRL WSTWDLKPVR EITFPKSNKP IISLTFSCDG
3760 3770 3780
HHLYTANSEG TVIAWCRKDQ QRVKLPMFYS FLSSYAAG
Length:3,788
Mass (Da):425,287
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF01BE837C676A750
GO
Isoform 2 (identifier: P97412-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1509-1545: EGDRPEVTESINPGDRLIEDGCIHLISLGSKALMIQV → GMMAGSDLYTKILQIAACLSFKHIWQYFNVFFKCYSP
     1546-3788: Missing.

Show »
Length:1,545
Mass (Da):172,458
Checksum:iA346094C0E5C419A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E8Q0G5E8Q0_MOUSE
Lysosomal trafficking regulator, is...
Lyst mCG_18823
3,787Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8W6Q6A0A2R8W6Q6_MOUSE
Lysosomal-trafficking regulator
Lyst
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0067831509 – 1545EGDRP…LMIQV → GMMAGSDLYTKILQIAACLS FKHIWQYFNVFFKCYSP in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0067841546 – 3788Missing in isoform 2. 1 PublicationAdd BLAST2243

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U70015 mRNA Translation: AAC53011.1
L77884 mRNA Translation: AAL40134.1
U52461 mRNA Translation: AAB60778.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T30851

NCBI Reference Sequences

More...
RefSeqi
NP_034878.2, NM_010748.2

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
17101

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:17101

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U70015 mRNA Translation: AAC53011.1
L77884 mRNA Translation: AAL40134.1
U52461 mRNA Translation: AAB60778.1
PIRiT30851
RefSeqiNP_034878.2, NM_010748.2

3D structure databases

SMRiP97412
ModBaseiSearch...

Protein-protein interaction databases

IntActiP97412, 1 interactor
MINTiP97412
STRINGi10090.ENSMUSP00000106188

PTM databases

iPTMnetiP97412
PhosphoSitePlusiP97412
SwissPalmiP97412

Proteomic databases

EPDiP97412
jPOSTiP97412
MaxQBiP97412
PaxDbiP97412
PeptideAtlasiP97412
PRIDEiP97412

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi17101
KEGGimmu:17101

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1130
MGIiMGI:107448 Lyst

Phylogenomic databases

eggNOGiKOG1786 Eukaryota
ENOG410XNQC LUCA
HOGENOMiHOG000113425
InParanoidiP97412
KOiK22937
OrthoDBi101142at2759
PhylomeDBiP97412

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Lyst mouse

Protein Ontology

More...
PROi
PR:P97412

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd06071 Beach, 1 hit
cd01201 PH_BEACH, 1 hit
Gene3Di1.10.1540.10, 1 hit
2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR000409 BEACH_dom
IPR036372 BEACH_dom_sf
IPR030464 LYST
IPR023362 PH-BEACH_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PANTHERiPTHR13743:SF86 PTHR13743:SF86, 1 hit
PfamiView protein in Pfam
PF02138 Beach, 1 hit
PF14844 PH_BEACH, 1 hit
PF00400 WD40, 1 hit
SMARTiView protein in SMART
SM01026 Beach, 1 hit
SM00320 WD40, 4 hits
SUPFAMiSSF48371 SSF48371, 1 hit
SSF50978 SSF50978, 1 hit
SSF81837 SSF81837, 1 hit
PROSITEiView protein in PROSITE
PS50197 BEACH, 1 hit
PS51783 PH_BEACH, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 1 hit
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLYST_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P97412
Secondary accession number(s): Q62403, Q8VBS6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: May 1, 1997
Last modified: September 18, 2019
This is version 150 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again