Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disabled homolog 1

Gene

Dab1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Adapter molecule functioning in neural development. May regulate SIAH1 activity.1 Publication

GO - Molecular functioni

  • phosphatidylinositol 3-kinase binding Source: MGI
  • phospholipid binding Source: UniProtKB
  • SH2 domain binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-MMU-8866376 Reelin signalling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Disabled homolog 1
Gene namesi
Name:Dab1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:108554 Dab1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi45K → A: Impairs binding to PtdIns(4,5)P2. 1 Publication1
Mutagenesisi82K → A: Abolishes binding to PtdIns(4,5)P2. 1 Publication1
Mutagenesisi114S → T: Abolishes interaction with APLP1. 1 Publication1
Mutagenesisi136H → R: Greatly impairs interaction with APLP1. 1 Publication1
Mutagenesisi158F → V: Abolishes interaction with APLP1. 1 Publication1
Mutagenesisi185Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-198 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-198; F-200; F-220 and F-232. 1 Publication1
Mutagenesisi198Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-200; F-220 and F-232. 1 Publication1
Mutagenesisi200Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-198. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-220 and F-232. 1 Publication1
Mutagenesisi220Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-232. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-232. Abolishes interaction with CRKL SH2 domain; when associated with F-232. 2 Publications1
Mutagenesisi232Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-220. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-220. Abolishes interaction with CRKL SH2 domain; when associated with F-220. 2 Publications1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000797691 – 588Disabled homolog 1Add BLAST588

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei198Phosphotyrosine2 Publications1
Modified residuei220Phosphotyrosine2 Publications1
Modified residuei232Phosphotyrosine2 Publications1
Modified residuei524Phosphoserine; by CDK51 Publication1

Post-translational modificationi

Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (PubMed:11279201). Also found phosphorylated on Tyr-232 upon reelin induction (PubMed:15062102). Also phosphorylated on Ser-524 independently of reelin signaling.4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP97318
PRIDEiP97318

PTM databases

iPTMnetiP97318
PhosphoSitePlusiP97318

Expressioni

Tissue specificityi

Expressed mainly in brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000028519 Expressed in 258 organ(s), highest expression level in lumbar subsegment of spinal cord
CleanExiMM_DAB1
ExpressionAtlasiP97318 baseline and differential
GenevisibleiP97318 MM

Interactioni

Subunit structurei

Associates with the SH2 domains of SRC, FYN and ABL. Interacts (phosphorylated on tyrosine residues) with CRK and CRKL (via respective SH2 domain) (PubMed:15062102). Interacts with SIAH1, LRP8 and VLDLR (PubMed:12646221, PubMed:12737822). Interacts with LRP1 (By similarity). Interacts with APLP1 (via NPXY motif) (PubMed:12826668). Interacts with DAB2IP (By similarity).By similarity5 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi199042, 13 interactors
DIPiDIP-30902N
ELMiP97318
IntActiP97318, 18 interactors
MINTiP97318

Structurei

Secondary structure

1588
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP97318
SMRiP97318
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP97318

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 189PIDPROSITE-ProRule annotationAdd BLAST154

Domaini

The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.

Phylogenomic databases

GeneTreeiENSGT00520000055585
HOVERGENiHBG018945
InParanoidiP97318
KOiK20054
OMAiLPSFWGQ
PhylomeDBiP97318
TreeFamiTF316724

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
PfamiView protein in Pfam
PF00640 PID, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform DAB588 (identifier: P97318-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTETELQVA VKTSAKKDSR KKGQDRSEAT LIKRFKGEGV RYKAKLIGID
60 70 80 90 100
EVSAARGDKL CQDSMMKLKG VVAGARSKGE HKQKIFLTIS FGGIKIFDEK
110 120 130 140 150
TGALQHHHAV HEISYIAKDI TDHRAFGYVC GKEGNHRFVA IKTAQAAEPV
160 170 180 190 200
ILDLRDLFQL IYELKQREEL EKKAQKDKQC EQAVYQTILE EDVEDPVYQY
210 220 230 240 250
IVFEAGHEPI RDPETEENIY QVPTSQKKEG VYDVPKSQPN SQPLEDFESR
260 270 280 290 300
FAAATPNRNL SMDFDELLEA TKVSAVTQLE LFGDMSTPPD ITSPPTPATP
310 320 330 340 350
GDAFLPSSSQ TLPGSADVFG SMSFGTAAVP SGYVAMGAVL PSFWGQQPLV
360 370 380 390 400
QQQIAMGAQP PVAQVIPGAQ PIAWGQPGLF PATQQAWPTV AGQFPPAAFM
410 420 430 440 450
PTQTVMPLAA AMFQGPLTPL ATVPGTNDSA RSSPQSDKPR QKMGKESFKD
460 470 480 490 500
FQMVQPPPVP SRKPDQPSLT CTSEAFSSYF NKVGVAQDTD DCDDFDISQL
510 520 530 540 550
NLTPVTSTTP STNSPPTPAP RQSSPSKSSA SHVSDPTADD IFEEGFESPS
560 570 580
KSEEQEAPDG SQASSTSDPF GEPSGEPSGD NISPQDGS
Note: No experimental confirmation available.
Length:588
Mass (Da):63,578
Last modified:June 1, 1998 - v2
Checksum:i08404220792B1DB4
GO
Isoform DAB197 (identifier: P97318-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-23: STETELQVAVKTSAKKDSRKKG → LC
     200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
     218-588: Missing.

Note: No experimental confirmation available.
Show »
Length:197
Mass (Da):22,236
Checksum:i6AF789B4EC7FF6E9
GO
Isoform DAB204 (identifier: P97318-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-204: YIVFE → NLQKN
     205-588: Missing.

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):23,077
Checksum:i36271043EFC36BB4
GO
Isoform DAB217 (identifier: P97318-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
     218-588: Missing.

Show »
Length:217
Mass (Da):24,394
Checksum:i17E7E398F5D1DC01
GO
Isoform DAB271 (identifier: P97318-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-272: Missing.
     275-304: AVTQLELFGDMSTPPDITSPPTPATPGDAF → SLVQSPAAERAEAESRTGPAEPGSILRPLG
     305-588: Missing.

Show »
Length:271
Mass (Da):30,296
Checksum:iFA4A8CE9812EB55C
GO
Isoform DAB553 (identifier: P97318-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-221: Missing.

Note: No experimental confirmation available.
Show »
Length:553
Mass (Da):59,415
Checksum:i8B281EE7C3CFD2F2
GO
Isoform DAB555 (identifier: P97318-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-272: Missing.

Show »
Length:555
Mass (Da):59,838
Checksum:i57A7130311954FE0
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z465F2Z465_MOUSE
Disabled homolog 1
Dab1
258Annotation score:
A0A0A0MQI4A0A0A0MQI4_MOUSE
Disabled homolog 1
Dab1
160Annotation score:
F6VRL0F6VRL0_MOUSE
Disabled homolog 1
Dab1
214Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29A → R in BAB24163 (PubMed:16141072).Curated1
Sequence conflicti239P → PVS in CAM17685 (PubMed:19468303).Curated1
Sequence conflicti239P → PVS in CAM26758 (PubMed:19468303).Curated1
Sequence conflicti248E → D in CAM17685 (PubMed:19468303).Curated1
Sequence conflicti248E → D in CAM26758 (PubMed:19468303).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0262052 – 23STETE…SRKKG → LC in isoform DAB197. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_026206187 – 221Missing in isoform DAB553. CuratedAdd BLAST35
Alternative sequenceiVSP_003841200 – 217YIVFE…PETEE → VISEPRQGFACSCEGSFD in isoform DAB197 and isoform DAB217. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_026208200 – 204YIVFE → NLQKN in isoform DAB204. Curated5
Alternative sequenceiVSP_026209205 – 588Missing in isoform DAB204. CuratedAdd BLAST384
Alternative sequenceiVSP_003842218 – 588Missing in isoform DAB197 and isoform DAB217. 2 PublicationsAdd BLAST371
Alternative sequenceiVSP_003843240 – 272Missing in isoform DAB555 and isoform DAB271. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_003844275 – 304AVTQL…PGDAF → SLVQSPAAERAEAESRTGPA EPGSILRPLG in isoform DAB271. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_003845305 – 588Missing in isoform DAB271. 1 PublicationAdd BLAST284

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08380 mRNA Translation: CAA69663.1
Y08379 mRNA Translation: CAA69662.1
Y08381 mRNA Translation: CAA69664.1
Y08383 Genomic DNA No translation available.
AK005640 mRNA Translation: BAB24163.1
AL627134, AL645483 Genomic DNA Translation: CAM26758.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26759.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26760.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26762.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26765.1
AL645483, AL627134 Genomic DNA Translation: CAM17685.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17686.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17687.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17689.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17690.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19059.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19060.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19062.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19063.1
CCDSiCCDS18413.1 [P97318-2]
RefSeqiNP_034144.1, NM_010014.3 [P97318-6]
NP_796233.2, NM_177259.4 [P97318-2]
XP_011238731.1, XM_011240429.2 [P97318-2]
UniGeneiMm.289682

Genome annotation databases

EnsembliENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519 [P97318-4]
ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519 [P97318-5]
ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519 [P97318-2]
GeneIDi13131
KEGGimmu:13131
UCSCiuc008txu.1 mouse [P97318-5]
uc008txv.2 mouse [P97318-6]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08380 mRNA Translation: CAA69663.1
Y08379 mRNA Translation: CAA69662.1
Y08381 mRNA Translation: CAA69664.1
Y08383 Genomic DNA No translation available.
AK005640 mRNA Translation: BAB24163.1
AL627134, AL645483 Genomic DNA Translation: CAM26758.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26759.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26760.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26762.1
AL627134, AL645483, AL669938 Genomic DNA Translation: CAM26765.1
AL645483, AL627134 Genomic DNA Translation: CAM17685.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17686.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17687.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17689.1
AL645483, AL627134, AL669938 Genomic DNA Translation: CAM17690.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19059.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19060.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19062.1
AL669938, AL627134, AL645483 Genomic DNA Translation: CAM19063.1
CCDSiCCDS18413.1 [P97318-2]
RefSeqiNP_034144.1, NM_010014.3 [P97318-6]
NP_796233.2, NM_177259.4 [P97318-2]
XP_011238731.1, XM_011240429.2 [P97318-2]
UniGeneiMm.289682

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1NTVX-ray1.50A23-174[»]
1NU2X-ray1.90A23-174[»]
1OQNX-ray2.30A/B25-183[»]
ProteinModelPortaliP97318
SMRiP97318
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199042, 13 interactors
DIPiDIP-30902N
ELMiP97318
IntActiP97318, 18 interactors
MINTiP97318

PTM databases

iPTMnetiP97318
PhosphoSitePlusiP97318

Proteomic databases

MaxQBiP97318
PRIDEiP97318

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519 [P97318-4]
ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519 [P97318-5]
ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519 [P97318-2]
GeneIDi13131
KEGGimmu:13131
UCSCiuc008txu.1 mouse [P97318-5]
uc008txv.2 mouse [P97318-6]

Organism-specific databases

CTDi1600
MGIiMGI:108554 Dab1

Phylogenomic databases

GeneTreeiENSGT00520000055585
HOVERGENiHBG018945
InParanoidiP97318
KOiK20054
OMAiLPSFWGQ
PhylomeDBiP97318
TreeFamiTF316724

Enzyme and pathway databases

ReactomeiR-MMU-8866376 Reelin signalling pathway

Miscellaneous databases

ChiTaRSiDab1 mouse
EvolutionaryTraceiP97318
PROiPR:P97318
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028519 Expressed in 258 organ(s), highest expression level in lumbar subsegment of spinal cord
CleanExiMM_DAB1
ExpressionAtlasiP97318 baseline and differential
GenevisibleiP97318 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
PfamiView protein in Pfam
PF00640 PID, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDAB1_MOUSE
AccessioniPrimary (citable) accession number: P97318
Secondary accession number(s): A2A963
, A2A964, A2A965, A2A966, A2A967, A2A970, P97316, P97317, Q9DAP9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 1998
Last modified: September 12, 2018
This is version 154 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again