Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (07 Oct 2020)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear factor of activated T-cells, cytoplasmic 3

Gene

Nfatc3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a regulator of transcriptional activation. Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 (By similarity). Along with NFATC4, involved in embryonic heart development (PubMed:12750314).By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi444 – 451By similarity8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Developmental protein, DNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2025928, Calcineurin activates NFAT
R-MMU-2871809, FCERI mediated Ca+2 mobilization
R-MMU-5607763, CLEC7A (Dectin-1) induces NFAT activation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 3
Short name:
NF-ATc3
Short name:
NFATc3
Alternative name(s):
NFATx
T-cell transcription factor NFAT4
Short name:
NF-AT4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nfatc3
Synonyms:Nfat4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:103296, Nfatc3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

At 10.5 dpc, knockout embryo exhibit normal heart development (PubMed:12750314). Adults show attenuated phenotype during calcineurin-induced cardiac hypertrophy compared to wild-type littermates (PubMed:12370307). Simultaneous knockout of NFATC3 and NFATC4 results in embryonic death soon after 10.5 dpc. Embryos appear normal at 9.5 dpc. At 10.5 dpc, they exhibit defects in cardiac development, including dilated thin translucent hearts, pericardial effusion and anemia. Despite a mild generalized developmental delay, the heads, tails, and limb buds are well developed. By 11.5 dpc, mutant embryos are either necrotic or resorbed (PubMed:12750314).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002051812 – 1075Nuclear factor of activated T-cells, cytoplasmic 3Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonineBy similarity1
Modified residuei344PhosphoserineCombined sources1
Modified residuei372PhosphoserineBy similarity1
Modified residuei1065PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P97305

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P97305

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P97305

PRoteomics IDEntifications database

More...
PRIDEi
P97305

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P97305

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P97305

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in thymus. Weakly expressed in muscle, spleen and kidney. Also expressed in lymph node. Expressed in the heart (PubMed:12370307).1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the developing heart at 13.5 and 16.5 dpc, during the transition from spongy to compact myocardium.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
P97305, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000104931

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P97305, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P97305

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati207 – 2231Add BLAST17
Repeati236 – 2522Add BLAST17
Repeati292 – 3083Add BLAST17
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini415 – 596RHDPROSITE-ProRule annotationAdd BLAST182

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni109 – 114Calcineurin-binding6
Regioni207 – 3083 X SP repeatsAdd BLAST102

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi273 – 275Nuclear localization signal3
Motifi686 – 688Nuclear localization signal3
Motifi1031 – 1040Nuclear export signal10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi24 – 29Poly-Pro6

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QWQ4, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P97305

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P97305

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit
2.60.40.340, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013783, Ig-like_fold
IPR014756, Ig_E-set
IPR002909, IPT_dom
IPR008366, NFAT
IPR008967, p53-like_TF_DNA-bd
IPR032397, RHD_dimer
IPR011539, RHD_DNA_bind_dom
IPR037059, RHD_DNA_bind_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12533, PTHR12533, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16179, RHD_dimer, 1 hit
PF00554, RHD_DNA_bind, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01789, NUCFACTORATC

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00429, IPT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49417, SSF49417, 1 hit
SSF81296, SSF81296, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50254, REL_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform X1 (identifier: P97305-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTTANCGAHD ELDFKLVFGE DGAPAPPPPG SRPADLEPDD CASIYIFNVD
60 70 80 90 100
PPPSTLTTPL CLPHHGLPSH SSVLSPSFQL QSHKNYEGTC EIPESKYSPL
110 120 130 140 150
GGPKPFECPS IQFTSISPNC QQELDAHEDD LQINDPEREF LERPSRDHLY
160 170 180 190 200
LPLEPSYRES SLSPSPASSI SSRSWFSDAS SCESLSHIYD DVDSELNEAA
210 220 230 240 250
ARFTLGSPLT SPGGSPGGCP GEESWHQQYG SGHSLSPRQS PCHSPRSSIT
260 270 280 290 300
DENWLSPRPA SGPSSRPTSP CGKRRHSSAE VCYAGSLSPH HSPVPSPGHS
310 320 330 340 350
PRGSVTEDTW LTAPVHTGSG LSPAPFPFQY CVETDIPLKT RKTSEDQAAI
360 370 380 390 400
LPGKLEICSD DQGNLSPSRE TSVDDGLGSQ YPLKKDSSGD QFLSVPSPFT
410 420 430 440 450
WSKPKPGHTP IFRTSSLPPL DWPLPTHFGQ CELKIEVQPK THHRAHYETE
460 470 480 490 500
GSRGAVKAST GGHPVVKLLG YSEKPINLQM FIGTADDRYL RPHAFYQVHR
510 520 530 540 550
ITGKTVATAS QEIIIASTKV LEIPLLPENN MSASIDCAGI LKLRNSDIEL
560 570 580 590 600
RKGETDIGRK NTRVRLVFRV HIPQPSGKVL SLQIASIPVE CSQRSAQELP
610 620 630 640 650
HIEKYSINSC SVNGGHEMIV TGSNFLPESK IIFLEKGQDG GPHWEVEGKI
660 670 680 690 700
IREKCQGAHI VLEVPPYHNP AVTSAVQVHF YLCNGKRKKS QSQRFTYTPV
710 720 730 740 750
LMKQEQREDT DLPSVPSLPV PHSAQAQRPS SETGHPHDRA MSAPGGLLCQ
760 770 780 790 800
VQPAYTSMVA STHLPQLQCR DEGAGKEQHI ATSSVMHQPF QVTPTSPIGS
810 820 830 840 850
SYQSIQTSMY NGPTCLPVNP ASSQEFDPVL FQQDAALSSL VNLGCQPLSP
860 870 880 890 900
IPFHSSNSDA TGHLLAHSPH SVQTPPHLQS MGYHCSNAGQ TALSSPVADQ
910 920 930 940 950
ITGQPSSHLQ PITYCPSHPG SATAASPAAS HPLASSPISG PSSPQLQPMP
960 970 980 990 1000
YQSPSSGTAS SPSPTTRMHS GQHSTQAQST GQGGLSVPSS LVCHSLCDPA
1010 1020 1030 1040 1050
SFPPGGATVS IKPEPEDQEP NFATIGLQDI TLDDVNEIIG RDMSQISVSQ
1060 1070
ATEVMRDTPL PGPASPDLMT SHSAH
Length:1,075
Mass (Da):115,451
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4ED38C9AA6F452BB
GO
Isoform X2 (identifier: P97305-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1035-1075: VNEIIGRDMSQISVSQATEVMRDTPLPGPASPDLMTSHSAH → DQLISDLEHQPSGSTEKWSNHSEFSCPVPFWRI

Show »
Length:1,067
Mass (Da):114,932
Checksum:iD3F228D966EE4C3C
GO
Isoform Delta-X (identifier: P97305-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-497: Missing.

Show »
Length:1,045
Mass (Da):111,911
Checksum:i8C7DB1A257C2BE6E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UZ64Q3UZ64_MOUSE
Nuclear factor of activated T-cells...
Nfatc3
1,076Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5B2U1B5B2U1_MOUSE
Nuclear factor of activated T-cells...
Nfatc3
1,060Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5B2U2B5B2U2_MOUSE
Nuclear factor of activated T-cells...
Nfatc3
1,068Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12 – 34LDFKL…GSRPA → PRRVLFSVSAQLPSRTRPGP SDL (PubMed:9017603).CuratedAdd BLAST23
Sequence conflicti57 – 61TTPLC → NSSLG in AAA93249 (PubMed:9017603).Curated5
Sequence conflicti68P → LQ (PubMed:9017603).Curated1
Sequence conflicti82 – 83SH → GY in AAA93249 (PubMed:9017603).Curated2
Sequence conflicti90 – 93CEIP → GDIS in AAA93249 (PubMed:9017603).Curated4
Sequence conflicti113F → I in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti121 – 124QQEL → HQGT in AAA93249 (PubMed:9017603).Curated4
Sequence conflicti132Q → H in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti140F → Y in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti641G → R in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti646V → A in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti707 – 734REDTD…SSETG → KEKTQICLQFHLCLCLILPS PEALLRDR in AAA93249 (PubMed:9017603).CuratedAdd BLAST28
Sequence conflicti746G → S in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti1075H → Q in AAA93249 (PubMed:9017603).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005603468 – 497Missing in isoform Delta-X. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_0056041035 – 1075VNEII…SHSAH → DQLISDLEHQPSGSTEKWSN HSEFSCPVPFWRI in isoform X2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D85612 mRNA Translation: BAA12833.1
U28807 mRNA Translation: AAA93249.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D85612 mRNA Translation: BAA12833.1
U28807 mRNA Translation: AAA93249.1

3D structure databases

SMRiP97305
ModBaseiSearch...

Protein-protein interaction databases

IntActiP97305, 1 interactor
STRINGi10090.ENSMUSP00000104931

PTM databases

iPTMnetiP97305
PhosphoSitePlusiP97305

Proteomic databases

jPOSTiP97305
MaxQBiP97305
PaxDbiP97305
PRIDEiP97305

Organism-specific databases

MGIiMGI:103296, Nfatc3

Phylogenomic databases

eggNOGiENOG502QWQ4, Eukaryota
InParanoidiP97305
PhylomeDBiP97305

Enzyme and pathway databases

ReactomeiR-MMU-2025928, Calcineurin activates NFAT
R-MMU-2871809, FCERI mediated Ca+2 mobilization
R-MMU-5607763, CLEC7A (Dectin-1) induces NFAT activation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nfatc3, mouse

Protein Ontology

More...
PROi
PR:P97305
RNActiP97305, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

Gene3Di2.60.40.10, 1 hit
2.60.40.340, 1 hit
InterProiView protein in InterPro
IPR013783, Ig-like_fold
IPR014756, Ig_E-set
IPR002909, IPT_dom
IPR008366, NFAT
IPR008967, p53-like_TF_DNA-bd
IPR032397, RHD_dimer
IPR011539, RHD_DNA_bind_dom
IPR037059, RHD_DNA_bind_dom_sf
PANTHERiPTHR12533, PTHR12533, 1 hit
PfamiView protein in Pfam
PF16179, RHD_dimer, 1 hit
PF00554, RHD_DNA_bind, 1 hit
PRINTSiPR01789, NUCFACTORATC
SMARTiView protein in SMART
SM00429, IPT, 1 hit
SUPFAMiSSF49417, SSF49417, 1 hit
SSF81296, SSF81296, 1 hit
PROSITEiView protein in PROSITE
PS50254, REL_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNFAC3_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P97305
Secondary accession number(s): Q60896
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: October 7, 2020
This is version 160 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again