Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (12 Aug 2020)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

AP-2 complex subunit alpha

Gene

AP-2alpha

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adaptins are components of the adapter complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. AP-2alpha is a subunit of the plasma membrane adapter.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cargo adaptor activity Source: GO_Central
  • clathrin adaptor activity Source: FlyBase

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processEndocytosis, Protein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-177504, Retrograde neurotrophin signalling
R-DME-437239, Recycling pathway of L1
R-DME-5099900, WNT5A-dependent internalization of FZD4
R-DME-5140745, WNT5A-dependent internalization of FZD2, FZD5 and ROR2
R-DME-6798695, Neutrophil degranulation
R-DME-8856825, Cargo recognition for clathrin-mediated endocytosis
R-DME-8856828, Clathrin-mediated endocytosis
R-DME-8866427, VLDLR internalisation and degradation
R-DME-8964038, LDL clearance

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P91926

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
AP-2 complex subunit alpha
Alternative name(s):
Alpha-adaptin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
ORF Names:CG4260
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0264855, AP-2alpha

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Coated pit, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001937351 – 940AP-2 complex subunit alphaAdd BLAST940

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei632Phosphoserine1 Publication1
Modified residuei634Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P91926

PRoteomics IDEntifications database

More...
PRIDEi
P91926

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P91926

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the Garland cells, imaginal disks, adult midgut precursors, the antenno-maxillary complex, the endoderm, the fat bodies, and the visceral mesoderm and cells of the CNS and PNS including neuroblasts, the presumptive stomatogastric nervous system, and the lateral chordotonal sense organs.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0264855, Expressed in embryonic/larval hemocyte (Drosophila) and 50 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P91926, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P91926, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Adaptor protein complex 2 (AP-2) is a heterotetramer composed of two large adaptins (alpha-type and beta-type subunits), a medium adaptin (mu-type subunit AP50) and a small adaptin (sigma-type subunit AP17).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
59467, 20 interactors

Protein interaction database and analysis system

More...
IntActi
P91926, 2 interactors

Molecular INTeraction database

More...
MINTi
P91926

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0088945

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P91926

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi644 – 715Asn-richAdd BLAST72

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1077, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182838

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003824_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P91926

KEGG Orthology (KO)

More...
KOi
K11824

Identification of Orthologs from Complete Genome Data

More...
OMAi
HNELFNC

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P91926

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit
3.30.310.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017104, AP2_complex_asu
IPR011989, ARM-like
IPR016024, ARM-type_fold
IPR002553, Clathrin/coatomer_adapt-like_N
IPR003164, Clathrin_a-adaptin_app_sub_C
IPR008152, Clathrin_a/b/g-adaptin_app_Ig
IPR013041, Clathrin_app_Ig-like_sf
IPR009028, Coatomer/calthrin_app_sub_C
IPR012295, TBP_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01602, Adaptin_N, 1 hit
PF02296, Alpha_adaptin_C, 1 hit
PF02883, Alpha_adaptinC2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037091, AP2_complex_alpha, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00809, Alpha_adaptinC2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371, SSF48371, 1 hit
SSF49348, SSF49348, 1 hit
SSF55711, SSF55711, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A (identifier: P91926-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPVRGDGMR GLAVFISDIR NCKSKEAEVK RINKELANIR SKFKGDKTLD
60 70 80 90 100
GYQKKKYVCK LLFIFLLGHD IDFGHMEAVN LLSSNKYSEK QIGYLFISVL
110 120 130 140 150
VNTNSDLIRL IIQSIKNDLQ SRNPVHVNLA LQCIANIGSR DMAESFSNEI
160 170 180 190 200
PKLLVSGDTM DVVKQSAALC LLRLFRSSPD IIPGGEWTSR IIHLLNDQHM
210 220 230 240 250
GVVTAATSLI DALVKRNPDE YKGCVNLAVS RLSRIVTASY TDLQDYTYYF
260 270 280 290 300
VPAPWLSVKL LRLLQNYNPV TEEAGVRARL NETLETILNK AQEPPKSKKV
310 320 330 340 350
QHSNAKNAVL FEAINLIIHS DSEPNLLVRA CNQLGQFLSN RETNLRYLAL
360 370 380 390 400
ESMCHLATSE FSHEEVKKHQ EVVILSMKME KDVSVRQMAV DLLYAMCDRG
410 420 430 440 450
NAEEIVQEML NYLETADYSI REEMVLKVAI LAEKYATDYT WYVDVILNLI
460 470 480 490 500
RIAGDYVSEE VWYRVIQIVI NREEVQGYAA KTVFEALQAP ACHENMVKVG
510 520 530 540 550
GYILGEFGNL IAGDSRSAPL VQFKLLHSKY HLCSPMTRAL LLSTYIKFIN
560 570 580 590 600
LFPEIRTNIQ DVFRQHSNLR SADAELQQRA SEYLQLSIVA STDVLATVLE
610 620 630 640 650
EMPSFPERES SILAVLKKKK PGRVPENEIR ESKSPAPLTS AAQNNALVNN
660 670 680 690 700
SHSKLNNSNA NTDLLGLSTP PSNNIGSGSN SNSTLIDVLG DMYGSNSNNN
710 720 730 740 750
SSAVYNTKKF LFKNNGVLFE NEMLQIGVKS EFRQNLGRLG LFYGNKTQVP
760 770 780 790 800
LTNFNPVLQW SAEDALKLNV QMKVVEPTLE AGAQIQQLLT AECIEDYADA
810 820 830 840 850
PTIEISFRYN GTQQKFSIKL PLSVNKFFEP TEMNAESFFA RWKNLSGEQQ
860 870 880 890 900
RSQKVFKAAQ PLDLPGARNK LMGFGMQLLD QVDPNPDNMV CAGIIHTQSQ
910 920 930 940
QVGCLMRLEP NKQAQMFRLT VRASKETVTR EICDLLTDQF
Length:940
Mass (Da):105,620
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF745045CD2C1D9C5
GO
Isoform B (identifier: P91926-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-21: APVRGDGMRGLAVFISDIRN → ERAEGCEVVSPIDQSRGGKESEASADESLLFY

Show »
Length:952
Mass (Da):106,935
Checksum:iA98F090B3B6464BE
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAO39461 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti325N → E in CAA73533 (PubMed:9285813).Curated1
Sequence conflicti489A → P in CAA73533 (PubMed:9285813).Curated1
Sequence conflicti587S → N in CAA73533 (PubMed:9285813).Curated1
Sequence conflicti709 – 712KFLF → FVS in CAA73533 (PubMed:9285813).Curated4
Sequence conflicti722 – 723EM → GK in CAA73533 (PubMed:9285813).Curated2
Sequence conflicti741 – 743LFY → FSN in CAA73533 (PubMed:9285813).Curated3
Sequence conflicti877Q → P in CAA73533 (PubMed:9285813).Curated1

<p>This subsection of the 'Sequence' section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Edited at position 207.2 Publications
Partially edited. Target of Adar.

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti207T → A in RNA edited version. 1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0231352 – 21APVRG…SDIRN → ERAEGCEVVSPIDQSRGGKE SEASADESLLFY in isoform B. CuratedAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y11104 mRNA Translation: CAA71991.1
Y13092 mRNA Translation: CAA73533.1
AE014134 Genomic DNA Translation: AAF56103.2
AE014134 Genomic DNA Translation: AAS64634.1
BT032839 mRNA Translation: ACD81853.1
BT003458 mRNA Translation: AAO39461.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_476819.2, NM_057471.6 [P91926-1]
NP_995607.1, NM_205885.2 [P91926-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0089488; FBpp0088490; FBgn0264855 [P91926-1]
FBtr0089489; FBpp0088945; FBgn0264855 [P91926-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
33211

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4260

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y11104 mRNA Translation: CAA71991.1
Y13092 mRNA Translation: CAA73533.1
AE014134 Genomic DNA Translation: AAF56103.2
AE014134 Genomic DNA Translation: AAS64634.1
BT032839 mRNA Translation: ACD81853.1
BT003458 mRNA Translation: AAO39461.1 Different initiation.
RefSeqiNP_476819.2, NM_057471.6 [P91926-1]
NP_995607.1, NM_205885.2 [P91926-2]

3D structure databases

SMRiP91926
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi59467, 20 interactors
IntActiP91926, 2 interactors
MINTiP91926
STRINGi7227.FBpp0088945

PTM databases

iPTMnetiP91926

Proteomic databases

PaxDbiP91926
PRIDEiP91926

Genome annotation databases

EnsemblMetazoaiFBtr0089488; FBpp0088490; FBgn0264855 [P91926-1]
FBtr0089489; FBpp0088945; FBgn0264855 [P91926-2]
GeneIDi33211
KEGGidme:Dmel_CG4260

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
33211
FlyBaseiFBgn0264855, AP-2alpha

Phylogenomic databases

eggNOGiKOG1077, Eukaryota
GeneTreeiENSGT00950000182838
HOGENOMiCLU_003824_1_0_1
InParanoidiP91926
KOiK11824
OMAiHNELFNC
PhylomeDBiP91926

Enzyme and pathway databases

ReactomeiR-DME-177504, Retrograde neurotrophin signalling
R-DME-437239, Recycling pathway of L1
R-DME-5099900, WNT5A-dependent internalization of FZD4
R-DME-5140745, WNT5A-dependent internalization of FZD2, FZD5 and ROR2
R-DME-6798695, Neutrophil degranulation
R-DME-8856825, Cargo recognition for clathrin-mediated endocytosis
R-DME-8856828, Clathrin-mediated endocytosis
R-DME-8866427, VLDLR internalisation and degradation
R-DME-8964038, LDL clearance
SignaLinkiP91926

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
33211, 0 hits in 5 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
33211

Protein Ontology

More...
PROi
PR:P91926

Gene expression databases

BgeeiFBgn0264855, Expressed in embryonic/larval hemocyte (Drosophila) and 50 other tissues
ExpressionAtlasiP91926, baseline and differential
GenevisibleiP91926, DM

Family and domain databases

Gene3Di1.25.10.10, 1 hit
3.30.310.10, 1 hit
InterProiView protein in InterPro
IPR017104, AP2_complex_asu
IPR011989, ARM-like
IPR016024, ARM-type_fold
IPR002553, Clathrin/coatomer_adapt-like_N
IPR003164, Clathrin_a-adaptin_app_sub_C
IPR008152, Clathrin_a/b/g-adaptin_app_Ig
IPR013041, Clathrin_app_Ig-like_sf
IPR009028, Coatomer/calthrin_app_sub_C
IPR012295, TBP_dom_sf
PfamiView protein in Pfam
PF01602, Adaptin_N, 1 hit
PF02296, Alpha_adaptin_C, 1 hit
PF02883, Alpha_adaptinC2, 1 hit
PIRSFiPIRSF037091, AP2_complex_alpha, 1 hit
SMARTiView protein in SMART
SM00809, Alpha_adaptinC2, 1 hit
SUPFAMiSSF48371, SSF48371, 1 hit
SSF49348, SSF49348, 1 hit
SSF55711, SSF55711, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAP2A_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P91926
Secondary accession number(s): B3DN51
, O01937, Q7KTZ5, Q86P64, Q9VPP4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: August 12, 2020
This is version 166 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again