Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 187 (26 Feb 2020)
Sequence version 3 (01 Feb 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Voltage-dependent calcium channel type A subunit alpha-1

Gene

cac

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, neurotransmitter release, gene expression, cell motility, cell division and cell death (By similarity). Probably encodes a dihydropyridine-insensitive current. Vital for survival to adulthood.By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei271Calcium ion selectivity and permeability1
Sitei621Calcium ion selectivity and permeability1
Sitei989Calcium ion selectivity and permeability1
Sitei1281Calcium ion selectivity and permeability1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi1366 – 1377PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Developmental protein, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-422356 Regulation of insulin secretion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent calcium channel type A subunit alpha-1
Alternative name(s):
Protein cacophony
Protein nightblind A
Protein no-on-transient B
Short name:
Dmca1A
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:cac
Synonyms:nbA, nonB
ORF Names:CG43368
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0263111 cac

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 38CytoplasmicSequence analysisAdd BLAST38
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei39 – 57Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini58 – 75ExtracellularSequence analysisAdd BLAST18
Transmembranei76 – 95Helical; Name=S2 of repeat ISequence analysisAdd BLAST20
Topological domaini96 – 107CytoplasmicSequence analysisAdd BLAST12
Transmembranei108 – 128Helical; Name=S3 of repeat ISequence analysisAdd BLAST21
Topological domaini129 – 133ExtracellularSequence analysis5
Transmembranei134 – 152Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini153 – 171CytoplasmicSequence analysisAdd BLAST19
Transmembranei172 – 191Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini192 – 288ExtracellularSequence analysisAdd BLAST97
Transmembranei289 – 313Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini314 – 441CytoplasmicSequence analysisAdd BLAST128
Transmembranei442 – 460Helical; Name=S1 of repeat IISequence analysisAdd BLAST19
Topological domaini461 – 475ExtracellularSequence analysisAdd BLAST15
Transmembranei476 – 495Helical; Name=S2 of repeat IISequence analysisAdd BLAST20
Topological domaini496 – 503CytoplasmicSequence analysis8
Transmembranei504 – 522Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini523 – 531ExtracellularSequence analysis9
Transmembranei532 – 550Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini551 – 569CytoplasmicSequence analysisAdd BLAST19
Transmembranei570 – 589Helical; Name=S5 of repeat IISequence analysisAdd BLAST20
Topological domaini590 – 642ExtracellularSequence analysisAdd BLAST53
Transmembranei643 – 667Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini668 – 767CytoplasmicSequence analysisAdd BLAST100
Transmembranei768 – 786Helical; Name=S1 of repeat IIISequence analysisAdd BLAST19
Topological domaini787 – 802ExtracellularSequence analysisAdd BLAST16
Transmembranei803 – 822Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini823 – 834CytoplasmicSequence analysisAdd BLAST12
Transmembranei835 – 853Helical; Name=S3 of repeat IIISequence analysisAdd BLAST19
Topological domaini854 – 866ExtracellularSequence analysisAdd BLAST13
Transmembranei867 – 885Helical; Name=S4 of repeat IIISequence analysisAdd BLAST19
Topological domaini886 – 904CytoplasmicSequence analysisAdd BLAST19
Transmembranei905 – 924Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini925 – 1013ExtracellularSequence analysisAdd BLAST89
Transmembranei1014 – 1038Helical; Name=S6 of repeat IIISequence analysisAdd BLAST25
Topological domaini1039 – 1093CytoplasmicSequence analysisAdd BLAST55
Transmembranei1094 – 1122Helical; Name=S1 of repeat IVSequence analysisAdd BLAST29
Topological domaini1123 – 1127ExtracellularSequence analysis5
Transmembranei1128 – 1147Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1148 – 1155CytoplasmicSequence analysis8
Transmembranei1156 – 1174Helical; Name=S3 of repeat IVSequence analysisAdd BLAST19
Topological domaini1175 – 1184ExtracellularSequence analysis10
Transmembranei1185 – 1203Helical; Name=S4 of repeat IVSequence analysisAdd BLAST19
Topological domaini1204 – 1222CytoplasmicSequence analysisAdd BLAST19
Transmembranei1223 – 1242Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1243 – 1308ExtracellularSequence analysisAdd BLAST66
Transmembranei1309 – 1333Helical; Name=S6 of repeat IVSequence analysisAdd BLAST25
Topological domaini1334 – 1851CytoplasmicSequence analysisAdd BLAST518

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1196R → Q: Homolog of Q-1664 variant in human. Partially rescues the cac-F and cac-J lethal phenotypes. Does not rescue the loss of synaptic transmission cac-F and cac-J variants. No effect on photoreceptor morphology. 1 Publication1
Mutagenesisi1205R → P: Homolog of P-1673 variant in human. Does not rescue cac-F and cac-J lethal phenotypes. Highly increases amplitude on the synaptic transmission. Induces severe neurodegeneration in both photoreceptor cell bodies and terminals. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539591 – 1851Voltage-dependent calcium channel type A subunit alpha-1Add BLAST1851

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi234N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi235N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi865N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1348Phosphoserine; by PKASequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P91645

PRoteomics IDEntifications database

More...
PRIDEi
P91645

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed widely in the embryonic nervous system.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression peaks in the first larval instar, midpupal, and late pupal stages. In late-stage embryos, it is expressed preferentially in the nervous system.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0263111 Expressed in head and 15 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P91645 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P91645 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
58563, 15 interactors

Protein interaction database and analysis system

More...
IntActi
P91645, 5 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0298326

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P91645

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati25 – 316IAdd BLAST292
Repeati427 – 670IIAdd BLAST244
Repeati762 – 1049IIIAdd BLAST288
Repeati1086 – 1347IVAdd BLAST262
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1353 – 1388EF-handPROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1306 – 1348Phenylalkylamine bindingBy similarityAdd BLAST43

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi396 – 402Poly-Glu7
Compositional biasi732 – 735Poly-Glu4
Compositional biasi1736 – 1802Arg-richAdd BLAST67

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410INF8 Eukaryota
COG1226 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000170242

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P91645

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P91645

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002048 EF_hand_dom
IPR031649 GPHH_dom
IPR005821 Ion_trans_dom
IPR014873 VDCC_a1su_IQ
IPR002077 VDCCAlpha1
IPR027359 Volt_channel_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08763 Ca_chan_IQ, 1 hit
PF16905 GPHH, 1 hit
PF00520 Ion_trans, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00167 CACHANNEL

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01062 Ca_chan_IQ, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50222 EF_HAND_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: At least 2 regions (Exon IS4 and Exon I/II) undergo alternative splicing. The total number of isoforms is currently not known.2 Publications

This entry has 6 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform E (identifier: P91645-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGPKKEENP PGGGPTSLFI LTEDNPIRKY TRFIIEWPPF EYAVLLTIIA
60 70 80 90 100
NCVVLALEEH LPGGDKTVLA QKLEKTEAYF LCIFCVEASL KILALGLVLH
110 120 130 140 150
KHSYLRNIWN IMDFFVVVTG FMTQYPQIGP EVDLRTLRAI RVLRPLKLVS
160 170 180 190 200
GIPSLQVVLK SIIKAMAPLL QIGLLVLFAI VIFAIIGLEF YSGALHKTCY
210 220 230 240 250
SLEDPNKLVK EGESETPCNT DNILEKATGS FVCNNTTSMC LEKWEGPNSG
260 270 280 290 300
ITSFDNIGFA MLTVFQCITM EGWTAILYWT NDALGSAFNW IYFVPLIVIG
310 320 330 340 350
SFFMLNLVLG VLSGEFSNER NRVERRMEFQ KCRFRAMFQT AMVSYLDWIT
360 370 380 390 400
QAEEVILAEE RTTEEEKMHI MEARRRNAAK RKKLKSLGKS KSTDTEEEEA
410 420 430 440 450
EEDYGDDGYL KTRSKPQGSC TGFWRAEKRF RFWIRHTVKT QWFYWFVIVL
460 470 480 490 500
VFLNTVCVAV EHYGQPSFLT EFLYYAEFIF LGLFMSEMFI KMYALGPRIY
510 520 530 540 550
FESSFNRFDC VVISGSIFEV IWSEVKGGSF GLSVLRALRL LRIFKVTKYW
560 570 580 590 600
SSLRNLVISL LNSMRSIISL LFLLFLFILI FALLGMQLFG GQFNLPGGTP
610 620 630 640 650
ETNFNTFPIA LLTVFQILTG EDWNEVMYQG IISQGGAQKG MIYSIYFIVL
660 670 680 690 700
VLFGNYTLLN VFLAIAVDNL ANAQELTAAE EEQVEEDKEK QLQELEKEME
710 720 730 740 750
ALQADGVHVE NGDGAVAPSK SKGKKKEEEK KEEEEVTEGP KPMLPYSSMF
760 770 780 790 800
ILSPTNPIRR GAHWVVNLPY FDFFIMVVIS MSSIALAAED PVRENSRRNK
810 820 830 840 850
ILNYFDYAFT GVFTIEMLLK IVDLGVILHP GSYLREFWNI MDAVVVICAA
860 870 880 890 900
VSFGFDMSGS SAGQNLSTIK SLRVLRVLRP LKTIKRVPKL KAVFDCVVNS
910 920 930 940 950
LKNVVNILIV YILFQFIFSV IGVQLFNGKF FYCTDESKHT SAECQGSYFK
960 970 980 990 1000
YEEDELLPKQ ELRVWKPRAF HYDNVAAAML TLFAVQTGEG WPQVLQHSMA
1010 1020 1030 1040 1050
ATYEDRGPIQ NFRIEMSIFY IVYFIVFPFF FVNIFVALII ITFQEQGEAE
1060 1070 1080 1090 1100
LQDGEIDKNQ KSCIDFTIGA RPLERYMPKN RNTFKYKVWR IVVSTPFEYF
1110 1120 1130 1140 1150
IMMLIVFNTL LLMMKYHNQG DMYEKSLKYI NMGFTGMFSV ETVLKIIGFG
1160 1170 1180 1190 1200
VKNFFKDPWN IFDLITVLGS IVDALWMEFG HDDSNSINVG FLRLFRAARL
1210 1220 1230 1240 1250
IKLLRQGYTI RILLWTFVQS FKALPYVCLL IAMLFFIYAI IGMQVFGNIK
1260 1270 1280 1290 1300
LGTVENSITR HNNFQSFIQG VMLLFRCATG EAWPNIMLAC LKGKACDDDA
1310 1320 1330 1340 1350
EKAPGEYCGS TLAYAYFVSF IFFCSFLMLN LFVAVIMDNF DYLTRDSSIL
1360 1370 1380 1390 1400
GAHHLDEFVR IWAEYDPNAT GKIHYTEMYD MLKNMDPPLG FGNKCPNRLA
1410 1420 1430 1440 1450
YKKLIRMNMP LDDELRVQFT TTLFALIREN LSIKMRAPEE MDQADMELRE
1460 1470 1480 1490 1500
TITNIWPLQA KKMLNLLVPP SDQLNKGKLS VGKIYAGFLI LESWRSTRFG
1510 1520 1530 1540 1550
QLDSGMPMLE LQDASRHPSQ ESLTGADAGH LHPGHSYMNG HRRSPSLRHN
1560 1570 1580 1590 1600
GSPLARSPSP RRRGHQYIHH DIGFSDTVSN VVEMVKETRH PRHGNSHPRY
1610 1620 1630 1640 1650
PRGSWSASTS PARSPSPSRY GGHLSRSKRT QLPYPTYGTT SLCQRSRSPS
1660 1670 1680 1690 1700
PARLQEMRER DRLGYGIDMG VTHVQHSYPT LASRRAGIGR RLPPTPSKPS
1710 1720 1730 1740 1750
TLQLKPTNIN FPKLNASPTH THHSTPHSVH SLPHHRDLLR DPRDMYYSSR
1760 1770 1780 1790 1800
ERERDRERLR DRDRDRDRDR LHEYDLRYEY RDRERELYER ERDREREVER
1810 1820 1830 1840 1850
ERLEYIAPLS FEQALAMGRT GRVLPSPVLN GFKPKSGLNP RHSDSDEEDW

C
Note: Has exons IS4B and I/IIA.
Length:1,851
Mass (Da):212,471
Last modified:February 1, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4CC958CFBAE05EC2
GO
Isoform A (identifier: P91645-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1181-1183: Missing.

Note: Has exons IS4B and I/IIA.Curated
Show »
Length:1,848
Mass (Da):212,103
Checksum:i4060158ECCA1E71D
GO
Isoform B (identifier: P91645-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-151: FMTQYPQIGPEVDLRTLRAIRVLRPLKLVSG → AMTIFAEANIDVDLRMLRSFRVLRPLKLVSR

Note: Has exons IS4A and I/IIA.Curated
Show »
Length:1,851
Mass (Da):212,535
Checksum:iB0B828B500629B68
GO
Isoform C (identifier: P91645-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     317-351: SNERNRVERRMEFQKCRFRAMFQTAMVSYLDWITQ → AKEREKVENRQEFLKLRRQQQLERELNGYVEWICK

Note: Has exons IS4B and I/IIB.Curated
Show »
Length:1,851
Mass (Da):212,490
Checksum:i4DFA94B271153F61
GO
Isoform D (identifier: P91645-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-151: FMTQYPQIGPEVDLRTLRAIRVLRPLKLVSG → AMTIFAEANIDVDLRMLRSFRVLRPLKLVSR
     317-351: SNERNRVERRMEFQKCRFRAMFQTAMVSYLDWITQ → AKEREKVENRQEFLKLRRQQQLERELNGYVEWICK
     1181-1183: Missing.

Note: Has exons IS4A and I/IIB.Curated
Show »
Length:1,848
Mass (Da):212,187
Checksum:i8711622AC51FAD79
GO
Isoform F (identifier: P91645-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-151: FMTQYPQIGPEVDLRTLRAIRVLRPLKLVSG → AMTIFAEANIDVDLRMLRSFRVLRPLKLVSR
     317-351: SNERNRVERRMEFQKCRFRAMFQTAMVSYLDWITQ → AKEREKVENRQEFLKLRRQQQLERELNGYVEWICK

Note: Has exons IS4A and I/IIB.Curated
Show »
Length:1,851
Mass (Da):212,554
Checksum:iB18BE4C8CB97FACB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q59E50Q59E50_DROME
Voltage-dependent L-type calcium ch...
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,850Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q59E51Q59E51_DROME
Voltage-dependent L-type calcium ch...
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,849Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q59E52Q59E52_DROME
Cacophony, isoform I
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,850Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NDV1M9NDV1_DROME
Cacophony, isoform O
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,851Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q59E53Q59E53_DROME
Cacophony, isoform H
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,849Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NGZ9M9NGZ9_DROME
Cacophony, isoform N
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,954Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NF25M9NF25_DROME
Cacophony, isoform M
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,783Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PHD4M9PHD4_DROME
Cacophony, isoform P
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,869Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NEE2M9NEE2_DROME
Cacophony, isoform L
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,926Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A4D6K1U1A0A4D6K1U1_DROME
Cacophony, isoform S
cac 13, alpha1A, Ca-alpha1A, Ca[[V]]2.1, CAC
1,852Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti514S → G in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti815I → M in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti839N → S in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti906N → S in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti937S → G in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti1016M → V in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti1185N → S in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti1269Q → H in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti1368N → G in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti1580N → D in AAC47406 (PubMed:8987815).Curated1
Sequence conflicti1602R → G in AAC47406 (PubMed:8987815).Curated1

<p>This subsection of the 'Sequence' section provides information relevant to all types of RNA editing events (conversion, insertion, deletion of nucleotides) that lead to one or more amino acid changes compared to the translation of the non-edited RNA version.<p><a href='/help/rna_editing' target='_top'>More...</a></p>RNA editingi

Partially edited. 11 sites are edited by Adar.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti284 – 1851Missing in cac-J; lethal at an embryonic stage; loss of synaptic transmission. 1 PublicationAdd BLAST1568
Natural varianti989E → K in cac-F; lethal at the larval stage 3; loss of synaptic transmission. 1 Publication1
Natural varianti1029F → I in cac-S; exhibits defects in the patterning of courtship lovesong and a subtle abnormality in visual physiology. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000952121 – 151FMTQY…KLVSG → AMTIFAEANIDVDLRMLRSF RVLRPLKLVSR in isoform F, isoform D and isoform B. CuratedAdd BLAST31
Alternative sequenceiVSP_000953317 – 351SNERN…DWITQ → AKEREKVENRQEFLKLRRQQ QLERELNGYVEWICK in isoform F, isoform D and isoform C. CuratedAdd BLAST35
Alternative sequenceiVSP_0127411181 – 1183Missing in isoform A and isoform D. Curated3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U55776 mRNA Translation: AAC47406.1
AE014298 Genomic DNA Translation: AAF48120.2
AE014298 Genomic DNA Translation: AAS65322.1
AE014298 Genomic DNA Translation: AAS65323.1
AE014298 Genomic DNA Translation: AAS65324.1
AE014298 Genomic DNA Translation: AAS65325.1
AE014298 Genomic DNA Translation: AAS65326.1
U88664 Genomic DNA Translation: AAB53271.1
U88665 Genomic DNA Translation: AAB53272.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T13980

NCBI Reference Sequences

More...
RefSeqi
NP_001245639.1, NM_001258710.2 [P91645-1]
NP_511133.2, NM_078578.5 [P91645-2]
NP_996416.1, NM_206693.5 [P91645-6]
NP_996417.1, NM_206694.4 [P91645-1]
NP_996418.1, NM_206695.4 [P91645-5]
NP_996419.1, NM_206696.5
NP_996420.1, NM_206697.4

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0307318; FBpp0298319; FBgn0263111 [P91645-2]
FBtr0307319; FBpp0298320; FBgn0263111 [P91645-5]
FBtr0307320; FBpp0298321; FBgn0263111 [P91645-6]
FBtr0307322; FBpp0298323; FBgn0263111 [P91645-1]
FBtr0308609; FBpp0300833; FBgn0263111 [P91645-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
32158

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG43368

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism, RNA editing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55776 mRNA Translation: AAC47406.1
AE014298 Genomic DNA Translation: AAF48120.2
AE014298 Genomic DNA Translation: AAS65322.1
AE014298 Genomic DNA Translation: AAS65323.1
AE014298 Genomic DNA Translation: AAS65324.1
AE014298 Genomic DNA Translation: AAS65325.1
AE014298 Genomic DNA Translation: AAS65326.1
U88664 Genomic DNA Translation: AAB53271.1
U88665 Genomic DNA Translation: AAB53272.1
PIRiT13980
RefSeqiNP_001245639.1, NM_001258710.2 [P91645-1]
NP_511133.2, NM_078578.5 [P91645-2]
NP_996416.1, NM_206693.5 [P91645-6]
NP_996417.1, NM_206694.4 [P91645-1]
NP_996418.1, NM_206695.4 [P91645-5]
NP_996419.1, NM_206696.5
NP_996420.1, NM_206697.4

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4Z89X-ray2.64a/b/c/d/e/f/g/h/i/j1688-1702[»]
4Z8AX-ray1.76B1688-1702[»]
SMRiP91645
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi58563, 15 interactors
IntActiP91645, 5 interactors
STRINGi7227.FBpp0298326

Proteomic databases

PaxDbiP91645
PRIDEiP91645

Genome annotation databases

EnsemblMetazoaiFBtr0307318; FBpp0298319; FBgn0263111 [P91645-2]
FBtr0307319; FBpp0298320; FBgn0263111 [P91645-5]
FBtr0307320; FBpp0298321; FBgn0263111 [P91645-6]
FBtr0307322; FBpp0298323; FBgn0263111 [P91645-1]
FBtr0308609; FBpp0300833; FBgn0263111 [P91645-1]
GeneIDi32158
KEGGidme:Dmel_CG43368

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
12285
FlyBaseiFBgn0263111 cac

Phylogenomic databases

eggNOGiENOG410INF8 Eukaryota
COG1226 LUCA
GeneTreeiENSGT00940000170242
InParanoidiP91645
PhylomeDBiP91645

Enzyme and pathway databases

ReactomeiR-DME-422356 Regulation of insulin secretion

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
32158

Protein Ontology

More...
PROi
PR:P91645

Gene expression databases

BgeeiFBgn0263111 Expressed in head and 15 other tissues
ExpressionAtlasiP91645 baseline and differential
GenevisibleiP91645 DM

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR002048 EF_hand_dom
IPR031649 GPHH_dom
IPR005821 Ion_trans_dom
IPR014873 VDCC_a1su_IQ
IPR002077 VDCCAlpha1
IPR027359 Volt_channel_dom_sf
PfamiView protein in Pfam
PF08763 Ca_chan_IQ, 1 hit
PF16905 GPHH, 1 hit
PF00520 Ion_trans, 4 hits
PRINTSiPR00167 CACHANNEL
SMARTiView protein in SMART
SM01062 Ca_chan_IQ, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAC1A_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P91645
Secondary accession number(s): O01713
, O01714, Q76NR8, Q76NR9, Q76NS0, Q9VYR8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: February 1, 2005
Last modified: February 26, 2020
This is version 187 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again