Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (07 Apr 2021)
Sequence version 1 (13 Sep 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Matrix-remodeling-associated protein 7

Gene

MXRA7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P84157

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Matrix-remodeling-associated protein 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MXRA7
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7541, MXRA7

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P84157

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000182534.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei7 – 27HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
439921

Open Targets

More...
OpenTargetsi
ENSG00000182534

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31342

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P84157, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MXRA7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
52783434

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000725861 – 204Matrix-remodeling-associated protein 7Add BLAST204

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei191PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P84157

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P84157

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P84157

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P84157

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P84157

PeptideAtlas

More...
PeptideAtlasi
P84157

PRoteomics IDEntifications database

More...
PRIDEi
P84157

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
57754 [P84157-1]
57755 [P84157-2]
57756 [P84157-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P84157

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P84157

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182534, Expressed in caudate nucleus and 250 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P84157, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P84157, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000182534, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
136132, 24 interactors

Protein interaction database and analysis system

More...
IntActi
P84157, 6 interactors

Molecular INTeraction database

More...
MINTi
P84157

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000348050

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P84157, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SAE0, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000165365

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_117235_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P84157

Identification of Orthologs from Complete Genome Data

More...
OMAi
EDSSFKY

Database of Orthologous Groups

More...
OrthoDBi
1284052at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P84157

TreeFam database of animal gene trees

More...
TreeFami
TF336065

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026622, Mxra7

The PANTHER Classification System

More...
PANTHERi
PTHR21845, PTHR21845, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P84157-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAPAELLAA LPALATALAL LLAWLLVRRG AAASPEPARA PPEPAPPAEA
60 70 80 90 100
TGAPAPSRPC APEPAASPAG PEEPGEPAGL GELGEPAGPG EPEGPGDPAA
110 120 130 140 150
APAEAEEQAV EARQEEEQDL DGEKGPSSEG PEEEDGEGFS FKYSPGKLRG
160 170 180 190 200
NQYKKMMTKE ELEEEQRVQK EQLAAIFKLM KDNKETFGEM SDGDVQEQLR

LYDM
Length:204
Mass (Da):21,466
Last modified:September 13, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3298195FCAC7AECF
GO
Isoform 2 (identifier: P84157-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-170: VQK → TEE
     171-204: Missing.

Show »
Length:170
Mass (Da):17,493
Checksum:iD3A7979306B63163
GO
Isoform 3 (identifier: P84157-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-204: VQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM → IELTSDLTSL

Show »
Length:177
Mass (Da):18,207
Checksum:iA0F859727A3949CF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6ZR64Q6ZR64_HUMAN
HBV PreS1-transactivated protein 1
MXRA7
213Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPS4K7EPS4_HUMAN
Matrix-remodeling-associated protei...
MXRA7
22Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQX8K7EQX8_HUMAN
Matrix-remodeling-associated protei...
MXRA7
15Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AW888225 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti80L → V (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024252168 – 204VQKEQ…RLYDM → IELTSDLTSL in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_022589168 – 170VQK → TEE in isoform 2. 1 Publication3
Alternative sequenceiVSP_022590171 – 204Missing in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC005837 Genomic DNA No translation available.
BC053983 mRNA Translation: AAH53983.1
AW888225 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32745.1 [P84157-1]
CCDS32746.1 [P84157-3]
CCDS45786.1 [P84157-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001008528.1, NM_001008528.2 [P84157-1]
NP_001008529.1, NM_001008529.2 [P84157-3]
NP_940932.2, NM_198530.3 [P84157-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000355797; ENSP00000348050; ENSG00000182534 [P84157-1]
ENST00000375036; ENSP00000364176; ENSG00000182534 [P84157-3]
ENST00000449428; ENSP00000391466; ENSG00000182534 [P84157-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
439921

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:439921

UCSC genome browser

More...
UCSCi
uc002jsk.2, human [P84157-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005837 Genomic DNA No translation available.
BC053983 mRNA Translation: AAH53983.1
AW888225 mRNA No translation available.
CCDSiCCDS32745.1 [P84157-1]
CCDS32746.1 [P84157-3]
CCDS45786.1 [P84157-2]
RefSeqiNP_001008528.1, NM_001008528.2 [P84157-1]
NP_001008529.1, NM_001008529.2 [P84157-3]
NP_940932.2, NM_198530.3 [P84157-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi136132, 24 interactors
IntActiP84157, 6 interactors
MINTiP84157
STRINGi9606.ENSP00000348050

PTM databases

iPTMnetiP84157
PhosphoSitePlusiP84157

Genetic variation databases

BioMutaiMXRA7
DMDMi52783434

Proteomic databases

EPDiP84157
jPOSTiP84157
MassIVEiP84157
MaxQBiP84157
PaxDbiP84157
PeptideAtlasiP84157
PRIDEiP84157
ProteomicsDBi57754 [P84157-1]
57755 [P84157-2]
57756 [P84157-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
46164, 41 antibodies

Genome annotation databases

EnsembliENST00000355797; ENSP00000348050; ENSG00000182534 [P84157-1]
ENST00000375036; ENSP00000364176; ENSG00000182534 [P84157-3]
ENST00000449428; ENSP00000391466; ENSG00000182534 [P84157-2]
GeneIDi439921
KEGGihsa:439921
UCSCiuc002jsk.2, human [P84157-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
439921
DisGeNETi439921

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MXRA7
HGNCiHGNC:7541, MXRA7
HPAiENSG00000182534, Low tissue specificity
neXtProtiNX_P84157
OpenTargetsiENSG00000182534
PharmGKBiPA31342
VEuPathDBiHostDB:ENSG00000182534.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502SAE0, Eukaryota
GeneTreeiENSGT00940000165365
HOGENOMiCLU_117235_0_0_1
InParanoidiP84157
OMAiEDSSFKY
OrthoDBi1284052at2759
PhylomeDBiP84157
TreeFamiTF336065

Enzyme and pathway databases

PathwayCommonsiP84157

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
439921, 62 hits in 994 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MXRA7, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
439921
PharosiP84157, Tdark

Protein Ontology

More...
PROi
PR:P84157
RNActiP84157, protein

Gene expression databases

BgeeiENSG00000182534, Expressed in caudate nucleus and 250 other tissues
ExpressionAtlasiP84157, baseline and differential
GenevisibleiP84157, HS

Family and domain databases

InterProiView protein in InterPro
IPR026622, Mxra7
PANTHERiPTHR21845, PTHR21845, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMXRA7_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P84157
Secondary accession number(s): Q0P5W3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: September 13, 2004
Last modified: April 7, 2021
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again