UniProtKB - P84090 (ERH_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P84090|ERH_HUMAN Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1 MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDF IDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
- Align
Enhancer of rudimentary homolog
ERH
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- methyl-CpG binding Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- RNA binding Source: UniProtKBInferred from high throughput direct assayi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- cell cycle Source: UniProtKB-KW
- nucleobase-containing compound metabolic process Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- positive regulation of Notch signaling pathway Source: InterPro
- pyrimidine nucleoside metabolic process Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- pyrimidine nucleotide biosynthetic process Source: InterPro
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Biological process | Cell cycle |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Enhancer of rudimentary homolog |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:ERH |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000100632.10 |
Human Gene Nomenclature Database More...HGNCi | HGNC:3447 ERH |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 601191 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P84090 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Other locations
- methylosome Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- midbody Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Organism-specific databases
DisGeNET More...DisGeNETi | 2079 |
Open Targets More...OpenTargetsi | ENSG00000100632 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27859 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | ERH |
Domain mapping of disease mutations (DMDM) More...DMDMi | 51317296 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | RemovedCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000219351 | 2 – 104 | Enhancer of rudimentary homologAdd BLAST | 103 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 2 | N-acetylserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 11 | PhosphothreonineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes covalent linkages of various types formed between two proteins (interchain cross-links) or between two parts of the same protein (intrachain cross-links), except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki | 12 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
|
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugationProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P84090 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P84090 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P84090 |
PeptideAtlas More...PeptideAtlasi | P84090 |
PRoteomics IDEntifications database More...PRIDEi | P84090 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 57749 |
Consortium for Top Down Proteomics More...TopDownProteomicsi | P84090 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P84090 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P84090 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.1"Cloning and mapping of a novel human cDNA homologous to DROER, the enhancer of the Drosophila melanogaster rudimentary gene."
Isomura M., Okui K., Fujiwara T., Shin S., Nakamura Y.
Genomics 32:125-127(1996) [PubMed] [Europe PMC] [Abstract]Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000100632 |
CleanEx database of gene expression profiles More...CleanExi | HS_ERH |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P84090 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P84090 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | HPA002567 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
<p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi
2 Publications<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.10"Human enhancer of rudimentary is a molecular partner of PDIP46/SKAR, a protein interacting with DNA polymerase delta and S6K1 and regulating cell growth."
Smyk A., Szuminska M., Uniewicz K.A., Graves L.M., Kozlowski P.
FEBS J. 273:4728-4741(2006) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH POLDIP3. - Ref.15"5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex."
Takai H., Masuda K., Sato T., Sakaguchi Y., Suzuki T., Suzuki T., Koyama-Nasu R., Nasu-Nishimura Y., Katou Y., Ogawa H., Morishita Y., Kozuka-Hata H., Oyama M., Todo T., Ino Y., Mukasa A., Saito N., Toyoshima C., Shirahige K., Akiyama T.
Cell Rep. 9:48-60(2014) [PubMed] [Europe PMC] [Abstract]Cited for: INTERACTION WITH CHTOP, IDENTIFICATION IN THE METHYLOSOME COMPLEX WITH PRMT1; PRMT5 AND WDR77.
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CHTOP | Q9Y3Y2 | 3 | EBI-711389,EBI-347794 | |
| CTDP1 | Q9Y5B0 | 2 | EBI-711389,EBI-2807555 | |
| FAM208B | Q5VWN6 | 3 | EBI-711389,EBI-745958 | |
| FAM208B | Q5VWN6-2 | 3 | EBI-711389,EBI-10172380 | |
| SNRPD3 | P62318 | 3 | EBI-711389,EBI-372789 |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 108390, 72 interactors |
CORUM comprehensive resource of mammalian protein complexes More...CORUMi | P84090 |
Database of interacting proteins More...DIPi | DIP-42473N |
Protein interaction database and analysis system More...IntActi | P84090, 44 interactors |
Molecular INTeraction database More...MINTi | P84090 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000451080 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 4 – 9 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 14 – 16 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 18 – 24 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 7 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 25 – 43 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 19 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 54 – 63 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 64 – 73 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 74 – 77 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 78 – 82 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 5 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 84 – 100 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 17 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P84090 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P84090 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P84090 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG1766 Eukaryota ENOG4111Z48 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000003316 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000246458 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG000348 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P84090 |
Identification of Orthologs from Complete Genome Data More...OMAi | RTWSDYE |
Database of Orthologous Groups More...OrthoDBi | EOG091G1CHJ |
Database for complete collections of gene phylogenies More...PhylomeDBi | P84090 |
TreeFam database of animal gene trees More...TreeFami | TF314568 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.30.2260.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR035912 EHR_sf IPR000781 Enh_rudimentary |
The PANTHER Classification System More...PANTHERi | PTHR12373 PTHR12373, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF01133 ER, 1 hit |
PIRSF; a whole-protein classification database More...PIRSFi | PIRSF016393 Enh_rudimentary, 1 hit |
ProDom; a protein domain database More...ProDomi | View protein in ProDom or Entries sharing at least one domain PD008105 Enh_rudimentary, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF143875 SSF143875, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01290 ER, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
10 20 30 40 50
MSHTILLVQP TKRPEGRTYA DYESVNECME GVCKMYEEHL KRMNPNSPSI
60 70 80 90 100
TYDISQLFDF IDDLADLSCL VYRADTQTYQ PYNKDWIKEK IYVLLRRQAQ
QAGK
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | D85758 mRNA Translation: BAA12865.1 U66871 mRNA Translation: AAC51172.1 BT006877 mRNA Translation: AAP35523.1 AK312186 mRNA Translation: BAG35119.1 CH471061 Genomic DNA Translation: EAW80989.1 BC014301 mRNA Translation: AAH14301.1 BC071709 mRNA Translation: AAH71709.1 CR450298 mRNA Translation: CAG29294.1 CR542178 mRNA Translation: CAG46975.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS9794.1 |
NCBI Reference Sequences More...RefSeqi | NP_004441.1, NM_004450.2 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.509791 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000557016; ENSP00000451080; ENSG00000100632 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 2079 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:2079 |
UCSC genome browser More...UCSCi | uc001xlc.3 human |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P84090 | Enhancer of rudimentary homolog | 104 | |||
| Enhancer of rudimentary homolog | ) | 104 | |||
| Enhancer of rudimentary homolog | 104 | ||||
| Enhancer of rudimentary homolog | 104 | ||||
| Enhancer of rudimentary homolog | 104 | ||||
| +69 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P84090 | Enhancer of rudimentary homolog | 104 | |||
| Enhancer of rudimentary homolog | ) | 104 | |||
| Enhancer of rudimentary homolog | 104 | ||||
| Enhancer of rudimentary homolog | 104 | ||||
| Enhancer of rudimentary homolog | 104 | ||||
| +69 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P84090 | Enhancer of rudimentary homolog | 104 | |||
| Enhancer of rudimentary homolog | ) | 104 | |||
| Enhancer of rudimentary homolog | 104 | ||||
| Enhancer of rudimentary homolog | 104 | ||||
| Enhancer of rudimentary homolog | 104 | ||||
| +69 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | D85758 mRNA Translation: BAA12865.1 U66871 mRNA Translation: AAC51172.1 BT006877 mRNA Translation: AAP35523.1 AK312186 mRNA Translation: BAG35119.1 CH471061 Genomic DNA Translation: EAW80989.1 BC014301 mRNA Translation: AAH14301.1 BC071709 mRNA Translation: AAH71709.1 CR450298 mRNA Translation: CAG29294.1 CR542178 mRNA Translation: CAG46975.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS9794.1 |
NCBI Reference Sequences More...RefSeqi | NP_004441.1, NM_004450.2 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.509791 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1W9G | X-ray | 2.00 | A/B | 1-104 | [»] | |
| 2NML | X-ray | 1.55 | A | 1-104 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P84090 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P84090 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 108390, 72 interactors |
CORUM comprehensive resource of mammalian protein complexes More...CORUMi | P84090 |
Database of interacting proteins More...DIPi | DIP-42473N |
Protein interaction database and analysis system More...IntActi | P84090, 44 interactors |
Molecular INTeraction database More...MINTi | P84090 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000451080 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P84090 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P84090 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | ERH |
Domain mapping of disease mutations (DMDM) More...DMDMi | 51317296 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P84090 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P84090 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P84090 |
PeptideAtlas More...PeptideAtlasi | P84090 |
PRoteomics IDEntifications database More...PRIDEi | P84090 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 57749 |
Consortium for Top Down Proteomics More...TopDownProteomicsi | P84090 |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 2079 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000557016; ENSP00000451080; ENSG00000100632 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 2079 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:2079 |
UCSC genome browser More...UCSCi | uc001xlc.3 human |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 2079 |
DisGeNET More...DisGeNETi | 2079 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000100632.10 |
GeneCards: human genes, protein and diseases More...GeneCardsi | ERH |
Human Gene Nomenclature Database More...HGNCi | HGNC:3447 ERH |
Human Protein Atlas More...HPAi | HPA002567 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 601191 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P84090 |
Open Targets More...OpenTargetsi | ENSG00000100632 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27859 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG1766 Eukaryota ENOG4111Z48 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00390000003316 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000246458 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG000348 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P84090 |
Identification of Orthologs from Complete Genome Data More...OMAi | RTWSDYE |
Database of Orthologous Groups More...OrthoDBi | EOG091G1CHJ |
Database for complete collections of gene phylogenies More...PhylomeDBi | P84090 |
TreeFam database of animal gene trees More...TreeFami | TF314568 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | ERH human |
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P84090 |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | ERH_(gene) |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 2079 |
Protein Ontology More...PROi | PR:P84090 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000100632 |
CleanEx database of gene expression profiles More...CleanExi | HS_ERH |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P84090 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P84090 HS |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.30.2260.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR035912 EHR_sf IPR000781 Enh_rudimentary |
The PANTHER Classification System More...PANTHERi | PTHR12373 PTHR12373, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF01133 ER, 1 hit |
PIRSF; a whole-protein classification database More...PIRSFi | PIRSF016393 Enh_rudimentary, 1 hit |
ProDom; a protein domain database More...ProDomi | View protein in ProDom or Entries sharing at least one domain PD008105 Enh_rudimentary, 1 hit |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF143875 SSF143875, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01290 ER, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | ERH_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P84090Primary (citable) accession number: P84090 Secondary accession number(s): B2R5H2, P70659, Q14259 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | August 16, 2004 |
| Last sequence update: | August 16, 2004 | |
| Last modified: | July 18, 2018 | |
| This is version 147 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- Human chromosome 14
Human chromosome 14: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references - SIMILARITY comments
Index of protein domains and families
