Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase WNK1

Gene

Wnk1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival, and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D and SGK1. Controls sodium and chloride ion transport by inhibiting the activity of WNK4, by either phosphorylating the kinase or via an interaction between WNK4 and the autoinhibitory domain of WNK1. WNK4 regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation. WNK1 may also play a role in actin cytoskeletal reorganization. Phosphorylates NEDD4L. Acts as a scaffold to inhibit SLC4A4, SLC26A6 as well as CFTR activities and surface expression, recruits STK39 which mediates the inhibition (PubMed:21317537, PubMed:23542070).3 Publications
Isoform 7: Dominant-negative regulator of the longer isoform 1. Does not have kinase activity, does not directly inhibit WNK4 and has no direct effect on sodium and chloride ion transport. Downregulates sodium-chloride cotransporter activity indirectly by inhibiting isoform 1, it associates with isoform 1 and attenuates its kinase activity. In kidney, may play an important role regulating sodium and potassium balance.By similarity

Caution

Was named WNK/'with no lysine(K)' because key residues for catalysis, including the lysine involved in ATP binding, are either not conserved or differ compared to the residues described in other kinase family proteins.By similarity
It is uncertain whether Met-1 or Met-214 is the initiator.Curated
HSN2 was originally thought to be an intronless gene lying within a WNK1 gene intron. It has been shown to be a nervous system-specific exon of WNK1 included in isoform 2 and isoform 3 (PubMed:18521183).1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.By similarity

Cofactori

Mg2+By similarity

Activity regulationi

By hypertonicity. Activation requires autophosphorylation of Ser-382. Phosphorylation of Ser-378 also promotes increased activity (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei231ATP; via amide nitrogenBy similarity1
Binding sitei351ATPBy similarity1
Active sitei368Proton acceptorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi301 – 304ATPBy similarity4

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Protein kinase inhibitor, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-2672351 Stimuli-sensing channels

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK1Curated (EC:2.7.11.1By similarity)
Alternative name(s):
Protein kinase lysine-deficient 1Imported
Protein kinase with no lysine 11 Publication
Gene namesi
Name:Wnk1Imported
Synonyms:Hsn21 Publication, Prkwnk1Imported
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2442092 Wnk1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi368D → A: No effect on inhibition of SLC4A4. 1 Publication1

Chemistry databases

ChEMBLiCHEMBL2176799

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000868201 – 2377Serine/threonine-protein kinase WNK1Add BLAST2377

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphothreonineCombined sources1
Modified residuei165PhosphoserineBy similarity1
Modified residuei172PhosphoserineBy similarity1
Modified residuei378Phosphoserine; by autocatalysisBy similarity1
Modified residuei382Phosphoserine; by autocatalysisBy similarity1
Modified residuei1256PhosphoserineBy similarity1
Modified residuei1973PhosphoserineBy similarity1
Modified residuei2006PhosphoserineBy similarity1
Modified residuei2007PhosphoserineBy similarity1
Modified residuei2022PhosphoserineBy similarity1
Modified residuei2024PhosphoserineBy similarity1
Modified residuei2027PhosphoserineCombined sources1
Modified residuei2116PhosphoserineBy similarity1
Modified residuei2265PhosphoserineCombined sources1
Modified residuei2281PhosphoserineCombined sources1
Modified residuei2365PhosphoserineBy similarity1
Modified residuei2367PhosphoserineBy similarity1

Post-translational modificationi

Autophosphorylation at Ser-382 is inhibited by intracellular calcium.By similarity
Ubiquitinated in vitro by the BCR(KLHL3) complex and in vivo by a BCR(KLHL2) complex, leading to proteasomal degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiP83741
PaxDbiP83741
PeptideAtlasiP83741
PRIDEiP83741

PTM databases

iPTMnetiP83741
PhosphoSitePlusiP83741

Expressioni

Tissue specificityi

Widely expressed in both adult and embryonic tissue, with highest levels observed in the testis and lower levels in heart, lung, kidney, placenta, brain and skeletal muscle. Expressed in pancreatic duct (PubMed:21317537). Two isoforms are expressed in heart, a single shorter isoform in the kidney. Locates to the distal convoluted tubule, the medullary collecting duct and the cortical collecting duct of the kidney. HSN2-containing isoform 2 and isoform 3 are restricted to the nervous system, expressed preferentially in sensory neurons than in motor neurons and in general more abundant in axons than in cell bodies (at protein level). In the DRG, predominantly expressed in the satellite cells that envelop sensory neurons, but low expression also observed in the cell bodies of neurons (at protein level). In the sciatic nerve, expressed in the Schwann cells that surround axons and in a mosaic distribution of axons (at protein level). In the spinal cord, expressed in superficial layers (LI and LII), as well as in the fibers of the Lissauer tract (at protein level). Also detected in the axon fibers of dorsolateral funiculus and lateral funiculus (at protein level).4 Publications

Gene expression databases

BgeeiENSMUSG00000045962 Expressed in 329 organ(s), highest expression level in endothelial cell of lymphatic vessel
CleanExiMM_WNK1
ExpressionAtlasiP83741 baseline and differential
GenevisibleiP83741 MM

Interactioni

Subunit structurei

Interacts with SYT2. Interacts with KLHL3, WNK3 and WNK4 (By similarity). Isoform 7: Interacts with isoform 1 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi231244, 1 interactor
STRINGi10090.ENSMUSP00000086017

Structurei

3D structure databases

ProteinModelPortaliP83741
SMRiP83741
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini221 – 479Protein kinasePROSITE-ProRule annotationAdd BLAST259

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni488 – 555Autoinhibitory domainBy similarityAdd BLAST68

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WNK subfamily.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0584 Eukaryota
ENOG410XQWZ LUCA
GeneTreeiENSGT00800000124049
HOVERGENiHBG079897
InParanoidiP83741
KOiK08867
OMAiTQVVHSA
OrthoDBiEOG091G06LL
PhylomeDBiP83741
TreeFamiTF315363

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR024678 Kinase_OSR1/WNK_CCT
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF12202 OSR1_C, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P83741-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDGAAEKQS GTPGFLTPPA PVPKNGSSSD SSVGEKLGAT VADSGVGRTE
60 70 80 90 100
EYRRRRHTMD KDSRGAAATT TPTEHRFFRR SVICDSNATA LELPGLPLSI
110 120 130 140 150
PQPSVPAVVP QSAPPEPHRE ETLTATVASQ VSQQPSAAAS PGEQAVVGSA
160 170 180 190 200
TTTVPSSTSK DRPVSQPSLV GSKEEPPPSR SGSGSGGASA KEAQEDRSQQ
210 220 230 240 250
QDDIEELETK AVGMSNDGRF LKFDIEIGRG SFKTVYKGLD TETTVEVAWC
260 270 280 290 300
ELQDRKLTKS ERQRFKEEAE MLKGLQHPNI VRFYDSWEST VKGKKCIVLV
310 320 330 340 350
TELMTSGTLK TYLKRFKVMK IKVLRSWCRQ ILKGLQFLHT RTPPIIHRDL
360 370 380 390 400
KCDNIFITGP TGSVKIGDLG LATLKRASFA KSVIGTPEFM APEMYEEKYD
410 420 430 440 450
ESVDVYAFGM CMLEMATSEY PYSECQNAAQ IYRRVTSGVK PASFDKVAIP
460 470 480 490 500
EVKEIIEGCI RQNKDERYSI KDLLNHAFFQ EETGVRVELA EEDDGEKIAI
510 520 530 540 550
KLWLRIEDIK KLKGKYKDNE AIEFSFDLER DVPEDVAQEM VESGYVCEGD
560 570 580 590 600
HKTMAKAIKD RVSLIKRKRE QRQLVREEQE KRKQEESSFK QQNEQQASVS
610 620 630 640 650
QAGIQQLSAA STGIPTAPAT SASVSTQVEP EEPEADQHQQ LQYQQPSISV
660 670 680 690 700
LSDGTIDSGQ GSSVFTESRV SSQQTVSYGS QHEQAHSTGT APGHTVSSIQ
710 720 730 740 750
AQSQPHGVYP PSSMAQGQNQ GQPSSSLAGV LSSQPIQHPQ QQGIQPTVPS
760 770 780 790 800
QQAVQYSLPQ AASSSEGTTA QPVSQPQVSA GTQLPVSQTV ATVQGEPHIP
810 820 830 840 850
VSTQPSVVPV HSGAHFLPMG QPIPTSLLPQ YPVSQIPIST PHVSTAQTGF
860 870 880 890 900
SSVPITMAAG INQPLLTLAS SATASSIPGG SPVVPNQLPT LLQPVNQLQS
910 920 930 940 950
QVHPQLLQPT TVQSIGIPAN LGQAAEGPLP SGDVLYQGFP SRLPPQYPGD
960 970 980 990 1000
SNIAPSSNVA SVCIHSTVLA PPSMPTEALA TQGYFPTVVQ PYVESTPLVP
1010 1020 1030 1040 1050
MGSVGGQVQV SQPAVSLTQQ PPTTSSQQAV LESTQGVSQA APPEQTPITQ
1060 1070 1080 1090 1100
SQPTQPVPLV TSADSAHSDV ASGMSDGNEN APSSSGRHEG RTTKRHYRKS
1110 1120 1130 1140 1150
VRSRSRHEKT SRPKLRILNV SNKGDRVVEC QLETHNRKMV TFKFDLDGDN
1160 1170 1180 1190 1200
PEEIATIMVN NDFILAIERE SFVAQVREII EKADEMLSED VSVEPEGDQG
1210 1220 1230 1240 1250
LESLQGKDDY GFPGSQKLEG EFKQPIAVSS MPQQIGVPTS SLTQVVHSAG
1260 1270 1280 1290 1300
RRFIVSPVPE SRLRESKVFT SDISDPVVAS TSQAPGMNLS HSASSLSLQQ
1310 1320 1330 1340 1350
AFSELKHGQM TEGPNTAPPN FNHMAGPTFS PFLASIAGVQ TVAASTPSVS
1360 1370 1380 1390 1400
VPITSSPLND ISTSVMQSET ALPTEKGIVG VTTTSTGVVA SGGLTTMSVS
1410 1420 1430 1440 1450
ESPTSSSAVS SSTVPAVVTV STPSQPVQAS TSGSIASSTG SFPPGTFSTT
1460 1470 1480 1490 1500
TATTMGSVVA PDAKPPTVLL QQVASNTAGV AIVTSVSTTT PFPGMASQPS
1510 1520 1530 1540 1550
LPLSSSTSAP TLAETMVVSA HSLDKASHSS TAGLGLSFCA PSSSSSSGTA
1560 1570 1580 1590 1600
VSTSVSQPGM VHPLVISSAV VSTPGLPQPV VPTSTPLLPQ VPNIPPLVQP
1610 1620 1630 1640 1650
VVNVPAVQQT LIHSQPQPAL LPNQPHTHCP EMDADTQSKA PGIDDIKTLE
1660 1670 1680 1690 1700
EKLRSLFSEH SSSGTQHASV SLETPLVVET TVTPGITTTA VAPSKLMTST
1710 1720 1730 1740 1750
TSTCLPPTSL PLGAAGMPVM PVGTPGQVST PGTHASAPVG TATGVKPGTT
1760 1770 1780 1790 1800
PPKPTKTVVP PVGTELSAGT VPCEQLPPFP GPSLIQSQQP LEDLDAQLRR
1810 1820 1830 1840 1850
TLSPETITVA PAVGPLSTMS STTVTEAGTR LQKDGTEGHV TATSSGAGVV
1860 1870 1880 1890 1900
KMGRFQVSVT MDDAQKERKN RSEDTKSVHF ESSTSESSVL SSSSPESTLV
1910 1920 1930 1940 1950
KPEPNGISIS GISLDVPDST HKAPTPEAKS DAGQPTKVGR FQVTTTANKV
1960 1970 1980 1990 2000
GRFSVSRTED KVTELKKEGP VTSPPFRDSE QTVIPAVIPK KEKPELAEPS
2010 2020 2030 2040 2050
HLNGPSSDLE AAFLSRGTED GSGSPHSPPH LCSKSLPVQN LSQSLSNSFN
2060 2070 2080 2090 2100
SSYMSSDNES DIEDEDLRLE LRRLREKHLK EIQDLQSRQK HEIESLYTKL
2110 2120 2130 2140 2150
GKVPPAVIIP PAAPLSGRRR RPTKSKGSKS SRSSSLGNKS PQLSGNLSGQ
2160 2170 2180 2190 2200
SGTSVLHPQQ TLHPAGNTPE TGHNQLLQPL KPSPSSDNLY SAFTSDGAIS
2210 2220 2230 2240 2250
VPSLSAPGQG TSSTNTVGGT VSSQAAQAQP PAMTSSRKGT FTDDLHKLVD
2260 2270 2280 2290 2300
NWARDAMNLS GRRGSKGHMN YEGPGMARKF SAPGQLCVPM TSNLGGSTPI
2310 2320 2330 2340 2350
SAASATSLGH FTKSMCPPQQ YGFPPAPFGT QWSGTGGPAP QPLGQFQPVG
2360 2370
TASLQNFNIS NLQKSISNPP GSNLRTT
Length:2,377
Mass (Da):250,934
Last modified:November 30, 2010 - v2
Checksum:i0C4D288CCE50B8C6
GO
Isoform 2 (identifier: P83741-2) [UniParc]FASTAAdd to basket
Also known as: Brain and spinal cord variant

The sequence of this isoform differs from the canonical sequence as follows:
     715-1032: AQGQNQGQPS...TTSSQQAVLE → PRRGRSMSVC...SQPQVSAGTQ

Note: This isoform which includes the HSN2 exon has been identified in human and mouse. The sequence shown here is the result of gene prediction.
Show »
Length:2,626
Mass (Da):279,185
Checksum:i1933C3D136EE2103
GO
Isoform 3 (identifier: P83741-3) [UniParc]FASTAAdd to basket
Also known as: Dorsal root ganglia and sciatic nerve variant, DRG and sciatic nerve variant

The sequence of this isoform differs from the canonical sequence as follows:
     715-936: AQGQNQGQPS...GPLPSGDVLY → PQSMAHPCGG...VSQPQVSAGT

Note: This isoform which includes the HSN2 exon has been identified in human and mouse. The sequence shown here is the result of gene prediction.
Show »
Length:2,635
Mass (Da):279,763
Checksum:i8E2B08C9DCB624BF
GO
Isoform 4 (identifier: P83741-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     784-1032: Missing.

Note: No experimental confirmation available.
Show »
Length:2,128
Mass (Da):225,405
Checksum:iA414E93D815771CE
GO
Isoform 5 (identifier: P83741-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     784-937: Missing.
     1787-1814: Missing.

Note: No experimental confirmation available.
Show »
Length:2,195
Mass (Da):232,203
Checksum:i43A9B0F75D83925D
GO
Isoform 6 (identifier: P83741-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     784-788: LPVSQ → VNSNF
     789-2377: Missing.

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:788
Mass (Da):86,037
Checksum:i75A4C9BD9B35580E
GO
Isoform 7 (identifier: P83741-7) [UniParc]FASTAAdd to basket
Also known as: KS-WNK1, Kidney-Specific1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-437: MSDGAAEKQS...AAQIYRRVTS → MDFMKKDFCSVFVIVNSHCCCCSQKDCINE
     543-2377: Missing.

Note: Kinase-defective isoform. Produced by alternative promoter usage and alternative splicing.1 Publication
Show »
Length:135
Mass (Da):15,643
Checksum:i652F45351044FFE8
GO

Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F7CC62F7CC62_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
405Annotation score:
A0A0R4J274A0A0R4J274_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
433Annotation score:
F6U2S8F6U2S8_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
281Annotation score:
F6S7V4F6S7V4_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
85Annotation score:
F6TAR7F6TAR7_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
200Annotation score:
F7CZC4F7CZC4_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
407Annotation score:
J3QPK0J3QPK0_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
238Annotation score:
F7B663F7B663_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
67Annotation score:
F7CBK9F7CBK9_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
213Annotation score:
F6V9V5F6V9V5_MOUSE
Serine/threonine-protein kinase WNK...
Wnk1
61Annotation score:
There is more potential isoformShow all

Sequence cautioni

The sequence AAI46010 differs from that shown. Probable cloning artifact.Curated
The sequence AAI46012 differs from that shown. Probable cloning artifact.Curated
The sequence BAD32213 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence DAA04493 differs from that shown. Reason: Erroneous gene model prediction. Includes 3' and 3' intronic sequences.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1220G → R in AAQ77243 (PubMed:14514722).Curated1
Sequence conflicti1230S → C in AAQ77243 (PubMed:14514722).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0585921 – 437MSDGA…RRVTS → MDFMKKDFCSVFVIVNSHCC CCSQKDCINE in isoform 7. Add BLAST437
Alternative sequenceiVSP_058593543 – 2377Missing in isoform 7. Add BLAST1835
Alternative sequenceiVSP_040271715 – 1032AQGQN…QAVLE → PRRGRSMSVCVPHLSAVPSL SRISPSAPSTPPPVLSAPLC PSLLRTAPEETFAEKLSKAL ESVLPMHSASQRKHRRSSLP SLFVTTPQSMAHPCGGTPTY PESQIFFPTIHERPVSFSPP PTCPPKVAISQRRKSTSFLE AQTRHFQPLLRTVGQNHLPP GSSPTNWTPEAIVMLGATAN RVNRELCEMQVQPVFEPTQI YSDYRPGLVLAEEAHYFIPQ ETVYLAGVHYQAQVAGQYEG ISYNSPVLSSPMKQISEQKP VPGGPASSSVFEFPSGQAFL VGHLQNLRLDSGPSPASPLS SISAPNSTDATHLKFHPVFV PHSAPAVLTNSNENRSNCVF EFHAQTPSSSGEGGGILPQR VYRNRQVAVDSNQEELSPQS VGLHCHLQPVTEEQRNNHAP ELTISVVEPMGQIWPIGSPE YSSDSSQITSSDLSDFQSPP PTGGTAAPFGSDVSLPFIRL PQTVLQESPLFFCFPQGTTS QQVLSASYSSGGSTLHPQAQ GQNQGQPSSSLAGVLSSQPI QHPQQQGIQPTVPSQQAVQY SLPQAASSSEGTTAQPVSQP QVSAGTQ in isoform 2. CuratedAdd BLAST318
Alternative sequenceiVSP_040272715 – 936AQGQN…GDVLY → PQSMAHPCGGTPTYPESQIF FPTIHERPVSFSPPPTCPPK VAISQRRKSTSFLEAQTRHF QPLLRTVGQNHLPPGSSPTN WTPEAIVMLGATANRVNREL CEMQVQPVFEPTQIYSDYRP GLVLAEEAHYFIPQETVYLA GVHYQAQVAGQYEGISYNSP VLSSPMKQISEQKPVPGGPA SSSVFEFPSGQAFLVGHLQN LRLDSGPSPASPLSSISAPN STDATHLKFHPVFVPHSAPA VLTNSNENRSNCVFEFHAQT PSSSGEGGGILPQRVYRNRQ VAVDSNQEELSPQSVGLHCH LQPVTEEQRNNHAPELTISV VEPMGQIWPIGSPEYSSDSS QITSSDLSDFQSPPPTGGTA APFGSDVSLPFIRLPQTVLQ ESPLFFCFPQGTTSQQVLSA SYSSGGSTLHPQAQGQNQGQ PSSSLAGVLSSQPIQHPQQQ GIQPTVPSQQAVQYSLPQAA SSSEGTTAQPVSQPQVSAGT in isoform 3. CuratedAdd BLAST222
Alternative sequenceiVSP_040273784 – 1032Missing in isoform 4. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_040274784 – 937Missing in isoform 5. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_040275784 – 788LPVSQ → VNSNF in isoform 6. 1 Publication5
Alternative sequenceiVSP_040276789 – 2377Missing in isoform 6. 1 PublicationAdd BLAST1589
Alternative sequenceiVSP_0402771787 – 1814Missing in isoform 5. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY309076 mRNA Translation: AAQ77243.1
AY319934 mRNA Translation: AAQ84611.1
AK172935 mRNA Translation: BAD32213.1 Different initiation.
AC113092 Genomic DNA No translation available.
AC117667 Genomic DNA No translation available.
BC056761 mRNA Translation: AAH56761.1
BC138445 mRNA Translation: AAI38446.1
BC145282 mRNA Translation: AAI45283.1
BC146009 mRNA Translation: AAI46010.1 Sequence problems.
BC146011 mRNA Translation: AAI46012.1 Sequence problems.
BC171955 mRNA Translation: AAI71955.1
AK133738 mRNA Translation: BAE21813.1
BK004107 Genomic DNA Translation: DAA04493.1 Sequence problems.
CCDSiCCDS20478.1 [P83741-1]
CCDS51888.1 [P83741-5]
CCDS57444.1 [P83741-3]
CCDS57445.1 [P83741-2]
CCDS85147.1 [P83741-4]
RefSeqiNP_001171949.1, NM_001185020.1 [P83741-4]
NP_001171950.1, NM_001185021.1 [P83741-5]
NP_001186012.1, NM_001199083.1 [P83741-2]
NP_001186013.1, NM_001199084.1 [P83741-3]
NP_941992.2, NM_198703.3 [P83741-1]
XP_017177038.1, XM_017321549.1 [P83741-1]
XP_017177043.1, XM_017321554.1 [P83741-5]
XP_017177046.1, XM_017321557.1 [P83741-4]
UniGeneiMm.333349

Genome annotation databases

EnsembliENSMUST00000060043; ENSMUSP00000063001; ENSMUSG00000045962 [P83741-1]
ENSMUST00000088644; ENSMUSP00000086017; ENSMUSG00000045962 [P83741-3]
ENSMUST00000088646; ENSMUSP00000086019; ENSMUSG00000045962 [P83741-5]
ENSMUST00000177761; ENSMUSP00000136777; ENSMUSG00000045962 [P83741-2]
ENSMUST00000203030; ENSMUSP00000145304; ENSMUSG00000045962 [P83741-4]
GeneIDi232341
KEGGimmu:232341
UCSCiuc009dmt.2 mouse [P83741-1]
uc009dmu.2 mouse [P83741-5]
uc009dmv.2 mouse [P83741-6]
uc012ers.1 mouse [P83741-3]
uc012ert.1 mouse [P83741-2]
uc012eru.1 mouse [P83741-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY309076 mRNA Translation: AAQ77243.1
AY319934 mRNA Translation: AAQ84611.1
AK172935 mRNA Translation: BAD32213.1 Different initiation.
AC113092 Genomic DNA No translation available.
AC117667 Genomic DNA No translation available.
BC056761 mRNA Translation: AAH56761.1
BC138445 mRNA Translation: AAI38446.1
BC145282 mRNA Translation: AAI45283.1
BC146009 mRNA Translation: AAI46010.1 Sequence problems.
BC146011 mRNA Translation: AAI46012.1 Sequence problems.
BC171955 mRNA Translation: AAI71955.1
AK133738 mRNA Translation: BAE21813.1
BK004107 Genomic DNA Translation: DAA04493.1 Sequence problems.
CCDSiCCDS20478.1 [P83741-1]
CCDS51888.1 [P83741-5]
CCDS57444.1 [P83741-3]
CCDS57445.1 [P83741-2]
CCDS85147.1 [P83741-4]
RefSeqiNP_001171949.1, NM_001185020.1 [P83741-4]
NP_001171950.1, NM_001185021.1 [P83741-5]
NP_001186012.1, NM_001199083.1 [P83741-2]
NP_001186013.1, NM_001199084.1 [P83741-3]
NP_941992.2, NM_198703.3 [P83741-1]
XP_017177038.1, XM_017321549.1 [P83741-1]
XP_017177043.1, XM_017321554.1 [P83741-5]
XP_017177046.1, XM_017321557.1 [P83741-4]
UniGeneiMm.333349

3D structure databases

ProteinModelPortaliP83741
SMRiP83741
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231244, 1 interactor
STRINGi10090.ENSMUSP00000086017

Chemistry databases

ChEMBLiCHEMBL2176799

PTM databases

iPTMnetiP83741
PhosphoSitePlusiP83741

Proteomic databases

MaxQBiP83741
PaxDbiP83741
PeptideAtlasiP83741
PRIDEiP83741

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000060043; ENSMUSP00000063001; ENSMUSG00000045962 [P83741-1]
ENSMUST00000088644; ENSMUSP00000086017; ENSMUSG00000045962 [P83741-3]
ENSMUST00000088646; ENSMUSP00000086019; ENSMUSG00000045962 [P83741-5]
ENSMUST00000177761; ENSMUSP00000136777; ENSMUSG00000045962 [P83741-2]
ENSMUST00000203030; ENSMUSP00000145304; ENSMUSG00000045962 [P83741-4]
GeneIDi232341
KEGGimmu:232341
UCSCiuc009dmt.2 mouse [P83741-1]
uc009dmu.2 mouse [P83741-5]
uc009dmv.2 mouse [P83741-6]
uc012ers.1 mouse [P83741-3]
uc012ert.1 mouse [P83741-2]
uc012eru.1 mouse [P83741-4]

Organism-specific databases

CTDi65125
MGIiMGI:2442092 Wnk1

Phylogenomic databases

eggNOGiKOG0584 Eukaryota
ENOG410XQWZ LUCA
GeneTreeiENSGT00800000124049
HOVERGENiHBG079897
InParanoidiP83741
KOiK08867
OMAiTQVVHSA
OrthoDBiEOG091G06LL
PhylomeDBiP83741
TreeFamiTF315363

Enzyme and pathway databases

ReactomeiR-MMU-2672351 Stimuli-sensing channels

Miscellaneous databases

ChiTaRSiWnk1 mouse
PROiPR:P83741
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000045962 Expressed in 329 organ(s), highest expression level in endothelial cell of lymphatic vessel
CleanExiMM_WNK1
ExpressionAtlasiP83741 baseline and differential
GenevisibleiP83741 MM

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR024678 Kinase_OSR1/WNK_CCT
IPR000719 Prot_kinase_dom
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF12202 OSR1_C, 1 hit
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiWNK1_MOUSE
AccessioniPrimary (citable) accession number: P83741
Secondary accession number(s): A6H6V1
, B2RRJ7, B7ZNJ4, Q3UZP3, Q6A083, Q6IFS6, Q6VYA0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: November 30, 2010
Last modified: October 10, 2018
This is version 154 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again