Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (16 Oct 2019)
Sequence version 4 (05 Oct 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

ADAMTS-like protein 3

Gene

ADAMTSL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Although strongly similar to members of the ADAMTS family it lacks the metalloprotease and disintegrin-like domains which are typical of that family.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5083635 Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214 O-glycosylation of TSR domain-containing proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ADAMTS-like protein 3
Short name:
ADAMTSL-3
Alternative name(s):
Punctin-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAMTSL3
Synonyms:KIAA1233
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14633 ADAMTSL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609199 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P82987

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57188

Open Targets

More...
OpenTargetsi
ENSG00000156218

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134934525

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P82987

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADAMTSL3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
308153648

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26Sequence analysisAdd BLAST26
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024968427 – 1691ADAMTS-like protein 3Add BLAST1665

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi87 ↔ 118By similarity
Disulfide bondi91 ↔ 123By similarity
Disulfide bondi102 ↔ 108By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi293N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi576 ↔ 620By similarity
Disulfide bondi580 ↔ 625By similarity
Disulfide bondi591 ↔ 609By similarity
Glycosylationi681N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi797N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi831 ↔ 875By similarity
Disulfide bondi835 ↔ 880By similarity
Disulfide bondi846 ↔ 863By similarity
Glycosylationi915N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi927N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi934 ↔ 982By similarity
Glycosylationi1102N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1191N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1215 ↔ 1263By similarity
Glycosylationi1292N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1316N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1321 ↔ 1367By similarity
Glycosylationi1330N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1343N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1349N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1356N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1432N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1516N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1574N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1591N-linked (GlcNAc...) asparagineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated (By similarity). Can be O-fucosylated by POFUT2 on a serine or a threonine residue found within the consensus sequence C1-X2-(S/T)-C2-G of the TSP type-1 repeat domains where C1 and C2 are the first and second cysteine residue of the repeat, respectively. Fucosylated repeats can then be further glycosylated by the addition of a beta-1,3-glucose residue by the glucosyltransferase, B3GALTL. Fucosylation mediates the efficient secretion of ADAMTS family members. Also can be C-glycosylated with one or two mannose molecules on tryptophan residues within the consensus sequence W-X-X-W of the TPRs, and N-glycosylated. These other glycosylations can also facilitate secretion (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P82987

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P82987

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P82987

PeptideAtlas

More...
PeptideAtlasi
P82987

PRoteomics IDEntifications database

More...
PRIDEi
P82987

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
57728 [P82987-1]
57729 [P82987-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P82987

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P82987

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in epithelial cells of the colon, fallopian tube, skin, breast, prostate, epididymis, liver, pancreatic islets and bile ducts, as well as by vascular endothelial cells, smooth muscle cells, fibroblasts, cortical and ganglionic neurons and cardiac myocytes. Also expressed by malignant epithelial cells in colon cancer, as well as breast, prostate, renal and skin tumors. Expression is significantly reduced in colon cancer compared to normal colon.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000156218 Expressed in 165 organ(s), highest expression level in pigmented layer of retina

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P82987 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034773
HPA034774

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121437, 6 interactors

Protein interaction database and analysis system

More...
IntActi
P82987, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000286744

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P82987

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini75 – 124TSP type-1 1PROSITE-ProRule annotationAdd BLAST50
Domaini418 – 468TSP type-1 2PROSITE-ProRule annotationAdd BLAST51
Domaini478 – 535TSP type-1 3PROSITE-ProRule annotationAdd BLAST58
Domaini564 – 626TSP type-1 4PROSITE-ProRule annotationAdd BLAST63
Domaini703 – 760TSP type-1 5PROSITE-ProRule annotationAdd BLAST58
Domaini763 – 818TSP type-1 6PROSITE-ProRule annotationAdd BLAST56
Domaini819 – 881TSP type-1 7PROSITE-ProRule annotationAdd BLAST63
Domaini896 – 992Ig-like C2-type 1Add BLAST97
Domaini1185 – 1279Ig-like C2-type 2Add BLAST95
Domaini1296 – 1378Ig-like C2-type 3Add BLAST83
Domaini1424 – 1482TSP type-1 8PROSITE-ProRule annotationAdd BLAST59
Domaini1483 – 1545TSP type-1 9PROSITE-ProRule annotationAdd BLAST63
Domaini1597 – 1644TSP type-1 10PROSITE-ProRule annotationAdd BLAST48
Domaini1655 – 1691PLACPROSITE-ProRule annotationAdd BLAST37

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410INDC Eukaryota
ENOG410YY5R LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158143

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230906

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P82987

Identification of Orthologs from Complete Genome Data

More...
OMAi
GMVFMHS

Database of Orthologous Groups

More...
OrthoDBi
38261at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P82987

TreeFam database of animal gene trees

More...
TreeFami
TF351125

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.20.100.10, 12 hits
2.60.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013273 ADAMTS/ADAMTS-like
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR010909 PLAC
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07679 I-set, 1 hit
PF08686 PLAC, 1 hit
PF00090 TSP_1, 9 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01857 ADAMTSFAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 3 hits
SM00408 IGc2, 3 hits
SM00209 TSP1, 12 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 3 hits
SSF82895 SSF82895, 12 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 3 hits
PS50900 PLAC, 1 hit
PS50092 TSP1, 10 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P82987-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASWTSPWWV LIGMVFMHSP LPQTTAEKSP GAYFLPEFAL SPQGSFLEDT
60 70 80 90 100
TGEQFLTYRY DDQTSRNTRS DEDKDGNWDA WGDWSDCSRT CGGGASYSLR
110 120 130 140 150
RCLTGRNCEG QNIRYKTCSN HDCPPDAEDF RAQQCSAYND VQYQGHYYEW
160 170 180 190 200
LPRYNDPAAP CALKCHAQGQ NLVVELAPKV LDGTRCNTDS LDMCISGICQ
210 220 230 240 250
AVGCDRQLGS NAKEDNCGVC AGDGSTCRLV RGQSKSHVSP EKREENVIAV
260 270 280 290 300
PLGSRSVRIT VKGPAHLFIE SKTLQGSKGE HSFNSPGVFL VENTTVEFQR
310 320 330 340 350
GSERQTFKIP GPLMADFIFK TRYTAAKDSV VQFFFYQPIS HQWRQTDFFP
360 370 380 390 400
CTVTCGGGYQ LNSAECVDIR LKRVVPDHYC HYYPENVKPK PKLKECSMDP
410 420 430 440 450
CPSSDGFKEI MPYDHFQPLP RWEHNPWTAC SVSCGGGIQR RSFVCVEESM
460 470 480 490 500
HGEILQVEEW KCMYAPKPKV MQTCNLFDCP KWIAMEWSQC TVTCGRGLRY
510 520 530 540 550
RVVLCINHRG EHVGGCNPQL KLHIKEECVI PIPCYKPKEK SPVEAKLPWL
560 570 580 590 600
KQAQELEETR IATEEPTFIP EPWSACSTTC GPGVQVREVK CRVLLTFTQT
610 620 630 640 650
ETELPEEECE GPKLPTERPC LLEACDESPA SRELDIPLPE DSETTYDWEY
660 670 680 690 700
AGFTPCTATC VGGHQEAIAV CLHIQTQQTV NDSLCDMVHR PPAMSQACNT
710 720 730 740 750
EPCPPRWHVG SWGPCSATCG VGIQTRDVYC LHPGETPAPP EECRDEKPHA
760 770 780 790 800
LQACNQFDCP PGWHIEEWQQ CSRTCGGGTQ NRRVTCRQLL TDGSFLNLSD
810 820 830 840 850
ELCQGPKASS HKSCARTDCP PHLAVGDWSK CSVSCGVGIQ RRKQVCQRLA
860 870 880 890 900
AKGRRIPLSE MMCRDLPGLP LVRSCQMPEC SKIKSEMKTK LGEQGPQILS
910 920 930 940 950
VQRVYIQTRE EKRINLTIGS RAYLLPNTSV IIKCPVRRFQ KSLIQWEKDG
960 970 980 990 1000
RCLQNSKRLG ITKSGSLKIH GLAAPDIGVY RCIAGSAQET VVLKLIGTDN
1010 1020 1030 1040 1050
RLIARPALRE PMREYPGMDH SEANSLGVTW HKMRQMWNNK NDLYLDDDHI
1060 1070 1080 1090 1100
SNQPFLRALL GHCSNSAGST NSWELKNKQF EAAVKQGAYS MDTAQFDELI
1110 1120 1130 1140 1150
RNMSQLMETG EVSDDLASQL IYQLVAELAK AQPTHMQWRG IQEETPPAAQ
1160 1170 1180 1190 1200
LRGETGSVSQ SSHAKNSGKL TFKPKGPVLM RQSQPPSISF NKTINSRIGN
1210 1220 1230 1240 1250
TVYITKRTEV INILCDLITP SEATYTWTKD GTLLQPSVKI ILDGTGKIQI
1260 1270 1280 1290 1300
QNPTRKEQGI YECSVANHLG SDVESSSVLY AEAPVILSVE RNITKPEHNH
1310 1320 1330 1340 1350
LSVVVGGIVE AALGANVTIR CPVKGVPQPN ITWLKRGGSL SGNVSLLFNG
1360 1370 1380 1390 1400
SLLLQNVSLE NEGTYVCIAT NALGKAVATS VLHLLERRWP ESRIVFLQGH
1410 1420 1430 1440 1450
KKYILQATNT RTNSNDPTGE PPPQEPFWEP GNWSHCSATC GHLGARIQRP
1460 1470 1480 1490 1500
QCVMANGQEV SEALCDHLQK PLAGFEPCNI RDCPARWFTS VWSQCSVSCG
1510 1520 1530 1540 1550
EGYHSRQVTC KRTKANGTVQ VVSPRACAPK DRPLGRKPCF GHPCVQWEPG
1560 1570 1580 1590 1600
NRCPGRCMGR AVRMQQRHTA CQHNSSDSNC DDRKRPTLRR NCTSGACDVC
1610 1620 1630 1640 1650
WHTGPWKPCT AACGRGFQSR KVDCIHTRSC KPVAKRHCVQ KKKPISWRHC
1660 1670 1680 1690
LGPSCDRDCT DTTHYCMFVK HLNLCSLDRY KQRCCQSCQE G
Length:1,691
Mass (Da):188,692
Last modified:October 5, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i48C7281C737EA56E
GO
Isoform 2 (identifier: P82987-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1657-1691: RDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQEG → STYTSQTATNKGAASHVKRDKPLEGS

Show »
Length:1,682
Mass (Da):187,240
Checksum:iEED57C7F66CA0CC6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti265A → V in AAK15041 (PubMed:14667842).Curated1
Sequence conflicti986S → F in AAI28390 (PubMed:15489334).Curated1
Sequence conflicti1526A → S in AAI28390 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027478146H → R1 PublicationCorresponds to variant dbSNP:rs4483821Ensembl.1
Natural variantiVAR_027479290L → V1 PublicationCorresponds to variant dbSNP:rs4144691Ensembl.1
Natural variantiVAR_035809330V → M in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1439091253Ensembl.1
Natural variantiVAR_035810587R → H in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs142860011Ensembl.1
Natural variantiVAR_027480661V → L1 PublicationCorresponds to variant dbSNP:rs4842838Ensembl.1
Natural variantiVAR_057365713G → R. Corresponds to variant dbSNP:rs34047645Ensembl.1
Natural variantiVAR_035811855R → C in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs146769560Ensembl.1
Natural variantiVAR_027481855R → H. Corresponds to variant dbSNP:rs2277848Ensembl.1
Natural variantiVAR_027482869L → F1 PublicationCorresponds to variant dbSNP:rs2277849Ensembl.1
Natural variantiVAR_0358121315A → E in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0274831370T → A. Corresponds to variant dbSNP:rs17158450Ensembl.1
Natural variantiVAR_0274841558M → T. Corresponds to variant dbSNP:rs7175910Ensembl.1
Natural variantiVAR_0274851660T → I. Corresponds to variant dbSNP:rs950169Ensembl.1
Natural variantiVAR_0274861679R → H. Corresponds to variant dbSNP:rs11857906Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0378101657 – 1691RDCTD…SCQEG → STYTSQTATNKGAASHVKRD KPLEGS in isoform 2. CuratedAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC087738 Genomic DNA No translation available.
AC116157 Genomic DNA No translation available.
AC027807 Genomic DNA No translation available.
BC128389 mRNA Translation: AAI28390.1
BC128390 mRNA Translation: AAI28391.1
AF237652 mRNA Translation: AAK15041.1
AB033059 mRNA Translation: BAA86547.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10326.1 [P82987-1]
CCDS73773.1 [P82987-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001288039.1, NM_001301110.1 [P82987-2]
NP_997400.2, NM_207517.2 [P82987-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000286744; ENSP00000286744; ENSG00000156218 [P82987-1]
ENST00000567476; ENSP00000456313; ENSG00000156218 [P82987-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57188

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57188

UCSC genome browser

More...
UCSCi
uc002bjz.5 human [P82987-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC087738 Genomic DNA No translation available.
AC116157 Genomic DNA No translation available.
AC027807 Genomic DNA No translation available.
BC128389 mRNA Translation: AAI28390.1
BC128390 mRNA Translation: AAI28391.1
AF237652 mRNA Translation: AAK15041.1
AB033059 mRNA Translation: BAA86547.1
CCDSiCCDS10326.1 [P82987-1]
CCDS73773.1 [P82987-2]
RefSeqiNP_001288039.1, NM_001301110.1 [P82987-2]
NP_997400.2, NM_207517.2 [P82987-1]

3D structure databases

SMRiP82987
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121437, 6 interactors
IntActiP82987, 12 interactors
STRINGi9606.ENSP00000286744

PTM databases

iPTMnetiP82987
PhosphoSitePlusiP82987

Polymorphism and mutation databases

BioMutaiADAMTSL3
DMDMi308153648

Proteomic databases

jPOSTiP82987
MassIVEiP82987
PaxDbiP82987
PeptideAtlasiP82987
PRIDEiP82987
ProteomicsDBi57728 [P82987-1]
57729 [P82987-2]

Genome annotation databases

EnsembliENST00000286744; ENSP00000286744; ENSG00000156218 [P82987-1]
ENST00000567476; ENSP00000456313; ENSG00000156218 [P82987-2]
GeneIDi57188
KEGGihsa:57188
UCSCiuc002bjz.5 human [P82987-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57188
DisGeNETi57188

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADAMTSL3
HGNCiHGNC:14633 ADAMTSL3
HPAiHPA034773
HPA034774
MIMi609199 gene
neXtProtiNX_P82987
OpenTargetsiENSG00000156218
PharmGKBiPA134934525

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410INDC Eukaryota
ENOG410YY5R LUCA
GeneTreeiENSGT00940000158143
HOGENOMiHOG000230906
InParanoidiP82987
OMAiGMVFMHS
OrthoDBi38261at2759
PhylomeDBiP82987
TreeFamiTF351125

Enzyme and pathway databases

ReactomeiR-HSA-5083635 Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214 O-glycosylation of TSR domain-containing proteins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ADAMTSL3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57188
PharosiP82987

Protein Ontology

More...
PROi
PR:P82987

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000156218 Expressed in 165 organ(s), highest expression level in pigmented layer of retina
GenevisibleiP82987 HS

Family and domain databases

Gene3Di2.20.100.10, 12 hits
2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR013273 ADAMTS/ADAMTS-like
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR010909 PLAC
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
PfamiView protein in Pfam
PF07679 I-set, 1 hit
PF08686 PLAC, 1 hit
PF00090 TSP_1, 9 hits
PRINTSiPR01857 ADAMTSFAMILY
SMARTiView protein in SMART
SM00409 IG, 3 hits
SM00408 IGc2, 3 hits
SM00209 TSP1, 12 hits
SUPFAMiSSF48726 SSF48726, 3 hits
SSF82895 SSF82895, 12 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 3 hits
PS50900 PLAC, 1 hit
PS50092 TSP1, 10 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATL3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P82987
Secondary accession number(s): A1A566, A1A567, Q9ULI7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: October 5, 2010
Last modified: October 16, 2019
This is version 128 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again