Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

28S ribosomal protein S25, mitochondrial

Gene

MRPS25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • structural constituent of ribosome Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Names & Taxonomyi

Protein namesi
Recommended name:
28S ribosomal protein S25, mitochondrial
Short name:
MRP-S25
Short name:
S25mt
Alternative name(s):
Mitochondrial small ribosomal subunit protein mS251 Publication
Gene namesi
Name:MRPS25
Synonyms:RPMS25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000131368.7
HGNCiHGNC:14511 MRPS25
MIMi611987 gene
neXtProtiNX_P82663

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000131368
PharmGKBiPA31013

Polymorphism and mutation databases

BioMutaiMRPS25
DMDMi13633894

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000877081 – 17328S ribosomal protein S25, mitochondrialAdd BLAST173

Proteomic databases

EPDiP82663
MaxQBiP82663
PaxDbiP82663
PeptideAtlasiP82663
PRIDEiP82663
ProteomicsDBi57710
TopDownProteomicsiP82663-1 [P82663-1]

PTM databases

iPTMnetiP82663
PhosphoSitePlusiP82663

Expressioni

Gene expression databases

BgeeiENSG00000131368 Expressed in 201 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_MRPS25
ExpressionAtlasiP82663 baseline and differential
GenevisibleiP82663 HS

Organism-specific databases

HPAiHPA043490

Interactioni

Subunit structurei

Component of the mitochondrial small ribosomal subunit (mt-SSU). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins.1 Publication

Protein-protein interaction databases

BioGridi122180, 80 interactors
CORUMiP82663
IntActiP82663, 21 interactors
MINTiP82663
STRINGi9606.ENSP00000253686

Structurei

3D structure databases

ProteinModelPortaliP82663
SMRiP82663
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG4079 Eukaryota
ENOG410YI66 LUCA
GeneTreeiENSGT00640000091558
HOGENOMiHOG000007270
HOVERGENiHBG002378
InParanoidiP82663
KOiK17404
OMAiCMCEVEG
OrthoDBiEOG091G0P9B
PhylomeDBiP82663
TreeFamiTF300292

Family and domain databases

InterProiView protein in InterPro
IPR040049 MRPS25
IPR007741 Ribosome/NADH_DH
IPR036249 Thioredoxin-like_sf
PANTHERiPTHR13274 PTHR13274, 1 hit
PfamiView protein in Pfam
PF05047 L51_S25_CI-B8, 1 hit
SMARTiView protein in SMART
SM00916 L51_S25_CI-B8, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P82663-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPMKGRFPIR RTLQYLSQGN VVFKDSVKVM TVNYNTHGEL GEGARKFVFF
60 70 80 90 100
NIPQIQYKNP WVQIMMFKNM TPSPFLRFYL DSGEQVLVDV ETKSNKEIME
110 120 130 140 150
HIRKILGKNE ETLREEEEEK KQLSHPANFG PRKYCLRECI CEVEGQVPCP
160 170
SLVPLPKEMR GKYKAALKAD AQD
Length:173
Mass (Da):20,116
Last modified:March 1, 2001 - v1
Checksum:i78BB282C1539FA4C
GO
Isoform 2 (identifier: P82663-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-173: ETLREEEEEK...KAALKADAQD → HYLAAPSKPVSSAVVPVTQEAEAGGSLEPRRLRLE

Note: No experimental confirmation available.
Show »
Length:145
Mass (Da):16,644
Checksum:iF6951457D5BB2DEA
GO
Isoform 3 (identifier: P82663-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-129: DSGEQVLVDV...KKQLSHPANF → GKPSGKRRRR...APAWCHYPRR
     130-173: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,953
Checksum:iC539192C27905D47
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EPW2E7EPW2_HUMAN
28S ribosomal protein S25, mitochon...
MRPS25
110Annotation score:

Sequence cautioni

The sequence BAB15723 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05642281 – 129DSGEQ…HPANF → GKPSGKRRRRKSSFLTQPTS ALESTACGSASVKWKGRCPA PAWCHYPRR in isoform 3. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_056423111 – 173ETLRE…ADAQD → HYLAAPSKPVSSAVVPVTQE AEAGGSLEPRRLRLE in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_056424130 – 173Missing in isoform 3. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024702 mRNA Translation: BAB14968.1
AK024433 mRNA Translation: BAB15723.1 Different initiation.
AK294123 mRNA Translation: BAG57456.1
AK298791 mRNA Translation: BAG60928.1
AC090954 Genomic DNA No translation available.
BC003590 mRNA Translation: AAH03590.1
CCDSiCCDS2622.1 [P82663-1]
RefSeqiNP_071942.1, NM_022497.4 [P82663-1]
UniGeneiHs.657764
Hs.715617

Genome annotation databases

EnsembliENST00000253686; ENSP00000253686; ENSG00000131368 [P82663-1]
ENST00000444840; ENSP00000407733; ENSG00000131368 [P82663-3]
ENST00000449354; ENSP00000390882; ENSG00000131368 [P82663-2]
GeneIDi64432
KEGGihsa:64432
UCSCiuc003bzl.4 human [P82663-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024702 mRNA Translation: BAB14968.1
AK024433 mRNA Translation: BAB15723.1 Different initiation.
AK294123 mRNA Translation: BAG57456.1
AK298791 mRNA Translation: BAG60928.1
AC090954 Genomic DNA No translation available.
BC003590 mRNA Translation: AAH03590.1
CCDSiCCDS2622.1 [P82663-1]
RefSeqiNP_071942.1, NM_022497.4 [P82663-1]
UniGeneiHs.657764
Hs.715617

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J9Melectron microscopy3.50AT1-173[»]
ProteinModelPortaliP82663
SMRiP82663
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122180, 80 interactors
CORUMiP82663
IntActiP82663, 21 interactors
MINTiP82663
STRINGi9606.ENSP00000253686

PTM databases

iPTMnetiP82663
PhosphoSitePlusiP82663

Polymorphism and mutation databases

BioMutaiMRPS25
DMDMi13633894

Proteomic databases

EPDiP82663
MaxQBiP82663
PaxDbiP82663
PeptideAtlasiP82663
PRIDEiP82663
ProteomicsDBi57710
TopDownProteomicsiP82663-1 [P82663-1]

Protocols and materials databases

DNASUi64432
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000253686; ENSP00000253686; ENSG00000131368 [P82663-1]
ENST00000444840; ENSP00000407733; ENSG00000131368 [P82663-3]
ENST00000449354; ENSP00000390882; ENSG00000131368 [P82663-2]
GeneIDi64432
KEGGihsa:64432
UCSCiuc003bzl.4 human [P82663-1]

Organism-specific databases

CTDi64432
EuPathDBiHostDB:ENSG00000131368.7
GeneCardsiMRPS25
HGNCiHGNC:14511 MRPS25
HPAiHPA043490
MIMi611987 gene
neXtProtiNX_P82663
OpenTargetsiENSG00000131368
PharmGKBiPA31013
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4079 Eukaryota
ENOG410YI66 LUCA
GeneTreeiENSGT00640000091558
HOGENOMiHOG000007270
HOVERGENiHBG002378
InParanoidiP82663
KOiK17404
OMAiCMCEVEG
OrthoDBiEOG091G0P9B
PhylomeDBiP82663
TreeFamiTF300292

Enzyme and pathway databases

ReactomeiR-HSA-5368286 Mitochondrial translation initiation
R-HSA-5389840 Mitochondrial translation elongation
R-HSA-5419276 Mitochondrial translation termination

Miscellaneous databases

ChiTaRSiMRPS25 human
GeneWikiiMRPS25
GenomeRNAii64432
PROiPR:P82663
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000131368 Expressed in 201 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_MRPS25
ExpressionAtlasiP82663 baseline and differential
GenevisibleiP82663 HS

Family and domain databases

InterProiView protein in InterPro
IPR040049 MRPS25
IPR007741 Ribosome/NADH_DH
IPR036249 Thioredoxin-like_sf
PANTHERiPTHR13274 PTHR13274, 1 hit
PfamiView protein in Pfam
PF05047 L51_S25_CI-B8, 1 hit
SMARTiView protein in SMART
SM00916 L51_S25_CI-B8, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRT25_HUMAN
AccessioniPrimary (citable) accession number: P82663
Secondary accession number(s): B4DFJ5, B4DQG6, Q9H7P5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 1, 2001
Last modified: November 7, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Ribosomal proteins
    Ribosomal proteins families and list of entries
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again