Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 153 (02 Jun 2021)
Sequence version 2 (13 Sep 2004)
Previous versions | rss
Add a publicationFeedback
Protein

cAMP-dependent protein kinase type II regulatory subunit

Gene

Pka-R2

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells (PubMed:10781603, PubMed:9196067).

Mediates membrane association by binding to anchoring proteins, such as Akap200 (PubMed:9196067, PubMed:12223401).

Might play an essential role in the regulation of neuronal activity in the brain (PubMed:10781603, PubMed:9196067).

3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei1893',5'-cAMP 1By similarity1
Binding sitei1983',5'-cAMP 1By similarity1
Binding sitei3113',5'-cAMP 2By similarity1
Binding sitei3203',5'-cAMP 2By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi124 – 2393',5'-cAMP 1Add BLAST116
Nucleotide bindingi242 – 3623',5'-cAMP 2Add BLAST121

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processBiological rhythms
LigandcAMP, cAMP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-163615, PKA activation
R-DME-164378, PKA activation in glucagon signalling
R-DME-180024, DARPP-32 events
R-DME-432040, Vasopressin regulates renal water homeostasis via Aquaporins
R-DME-442720, CREB1 phosphorylation through the activation of Adenylate Cyclase
R-DME-5610787, Hedgehog 'off' state
R-DME-983231, Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
cAMP-dependent protein kinase type II regulatory subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pka-R2
Synonyms:pka-RII
ORF Names:CG15862
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0022382, Pka-R2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown increases ethanol sedation sensitivity when first exposed to ethanol and decreases ethanol tolerance following repeated ethanol exposure.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002053971 – 377cAMP-dependent protein kinase type II regulatory subunitAdd BLAST377

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei51Phosphoserine1 Publication1
Modified residuei58Phosphoserine1 Publication1
Modified residuei64Phosphoserine1 Publication1
Modified residuei67Phosphoserine1 Publication1
Modified residuei84Phosphoserine1 Publication1
Modified residuei90Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The pseudophosphorylation site binds to the substrate-binding region of the catalytic chain but is not phosphorylated. The physiological significance of phosphorylations by other kinases is unclear (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P81900

PRoteomics IDEntifications database

More...
PRIDEi
P81900

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P81900

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in follicle cells, germline-derived cells, germline line stem cells and outer rim of ring canals of nurse cells throughout oogenesis (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0022382, Expressed in central nervous system and 41 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P81900, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Tetramer, composed of 2 regulatory (R) and 2 catalytic (C) subunits (PubMed:9196067). In the presence of cAMP it dissociates into 2 active monomeric C subunits and an R dimer (By similarity).

Interacts with Akap200 (PubMed:10480936).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
61869, 9 interactors

Protein interaction database and analysis system

More...
IntActi
P81900, 24 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0087524

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P81900

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni48 – 78DisorderedSequence analysisAdd BLAST31

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi81 – 85Pseudophosphorylation motif5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi48 – 69Polar residuesSequence analysisAdd BLAST22

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1113, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154836

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018310_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P81900

Identification of Orthologs from Complete Genome Data

More...
OMAi
QYNFGRR

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P81900

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00038, CAP_ED, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012198, cAMP_dep_PK_reg_su
IPR018490, cNMP-bd-like
IPR018488, cNMP-bd_CS
IPR000595, cNMP-bd_dom
IPR014710, RmlC-like_jellyroll

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00027, cNMP_binding, 2 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000548, PK_regulatory, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00100, cNMP, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51206, SSF51206, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00888, CNMP_BINDING_1, 2 hits
PS00889, CNMP_BINDING_2, 2 hits
PS50042, CNMP_BINDING_3, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform AImported (identifier: P81900-1) [UniParc]FASTAAdd to basket
Also known as: BImported

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSDSSRRIQ VPEELKEVLL QFSISFLVEQ PPDVIDYAVE YFTKLQSERP
60 70 80 90 100
SVSHTDQSTD DQLSVNSQDA DAEPPVMASS RRKSVFAEAY DPEADDDDDG
110 120 130 140 150
ATAVFPKTDE QRARLVESVK NVLLFRSLEK EQMNQVLDAM FERKVQPGDF
160 170 180 190 200
IIRQGDDGDN FYVIESGVYK VYINDKHINT YNHTGLFGEL ALLYNMPRAA
210 220 230 240 250
TVQAETSGLL WAMDRQTFRR ILLKSAFRKR KMYEELLNSV PMLKALQNYE
260 270 280 290 300
RMNLADALVS KSYDNGERII KQGDAADGMY FIEEGTVSVR MDQDDAEVEI
310 320 330 340 350
SQLGKGQYFG ELALVTHRPR AASVYATGGV VKLAFLDVKA FERLLGPCMD
360 370
IMKRNIDDYE SQLVKIFGSK NNITDTR
Length:377
Mass (Da):42,748
Last modified:September 13, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i26C9EF6562CCACCC
GO
Isoform EImported (identifier: P81900-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     339-340: KA → IC
     345-377: LGPCMDIMKRNIDDYESQLVKIFGSKNNITDTR → MGKCSGGIQRSISGYRYLEQDLREYFGNLPLN

Show »
Length:376
Mass (Da):42,615
Checksum:i0DA0E64CBF84896E
GO
Isoform DImported (identifier: P81900-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     338-377: VKAFERLLGP...GSKNNITDTR → TEAFERIMGF...TDMARRNTNL

Show »
Length:373
Mass (Da):42,426
Checksum:iA9E2BDADDA9F0C4A
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABL75628 differs from that shown.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_058165338 – 377VKAFE…ITDTR → TEAFERIMGFLTDVLKRNIV IYEQMFTDMARRNTNL in isoform D. CuratedAdd BLAST40
Alternative sequenceiVSP_026945339 – 340KA → IC in isoform E. 1 Publication2
Alternative sequenceiVSP_026946345 – 377LGPCM…ITDTR → MGKCSGGIQRSISGYRYLEQ DLREYFGNLPLN in isoform E. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF274008 mRNA Translation: AAF86976.1
AE013599 Genomic DNA Translation: AAF58862.2
AE013599 Genomic DNA Translation: AAM71046.3
AE013599 Genomic DNA Translation: ABV53747.1
AE013599 Genomic DNA Translation: ABV53748.1
AY069669 mRNA Translation: AAL39814.1
BT029569 mRNA Translation: ABL75628.1 Sequence problems.
BT029610 mRNA Translation: ABL75669.1
BT029637 mRNA Translation: ABL75696.1
BT029963 mRNA Translation: ABM92837.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097251.1, NM_001103781.3 [P81900-5]
NP_001097252.1, NM_001103782.2 [P81900-2]
NP_523671.1, NM_078947.4 [P81900-1]
NP_724860.2, NM_165723.4 [P81900-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0088437; FBpp0087523; FBgn0022382 [P81900-1]
FBtr0088438; FBpp0087524; FBgn0022382 [P81900-1]
FBtr0112901; FBpp0111814; FBgn0022382 [P81900-5]
FBtr0112902; FBpp0111815; FBgn0022382 [P81900-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
36041

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG15862

UCSC genome browser

More...
UCSCi
CG15862-RD, d. melanogaster
CG15862-RE, d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274008 mRNA Translation: AAF86976.1
AE013599 Genomic DNA Translation: AAF58862.2
AE013599 Genomic DNA Translation: AAM71046.3
AE013599 Genomic DNA Translation: ABV53747.1
AE013599 Genomic DNA Translation: ABV53748.1
AY069669 mRNA Translation: AAL39814.1
BT029569 mRNA Translation: ABL75628.1 Sequence problems.
BT029610 mRNA Translation: ABL75669.1
BT029637 mRNA Translation: ABL75696.1
BT029963 mRNA Translation: ABM92837.1
RefSeqiNP_001097251.1, NM_001103781.3 [P81900-5]
NP_001097252.1, NM_001103782.2 [P81900-2]
NP_523671.1, NM_078947.4 [P81900-1]
NP_724860.2, NM_165723.4 [P81900-1]

3D structure databases

SMRiP81900
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi61869, 9 interactors
IntActiP81900, 24 interactors
STRINGi7227.FBpp0087524

PTM databases

iPTMnetiP81900

Proteomic databases

PaxDbiP81900
PRIDEiP81900

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
36041

Genome annotation databases

EnsemblMetazoaiFBtr0088437; FBpp0087523; FBgn0022382 [P81900-1]
FBtr0088438; FBpp0087524; FBgn0022382 [P81900-1]
FBtr0112901; FBpp0111814; FBgn0022382 [P81900-5]
FBtr0112902; FBpp0111815; FBgn0022382 [P81900-2]
GeneIDi36041
KEGGidme:Dmel_CG15862
UCSCiCG15862-RD, d. melanogaster
CG15862-RE, d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
36041
FlyBaseiFBgn0022382, Pka-R2

Phylogenomic databases

eggNOGiKOG1113, Eukaryota
GeneTreeiENSGT00940000154836
HOGENOMiCLU_018310_1_1_1
InParanoidiP81900
OMAiQYNFGRR
PhylomeDBiP81900

Enzyme and pathway databases

ReactomeiR-DME-163615, PKA activation
R-DME-164378, PKA activation in glucagon signalling
R-DME-180024, DARPP-32 events
R-DME-432040, Vasopressin regulates renal water homeostasis via Aquaporins
R-DME-442720, CREB1 phosphorylation through the activation of Adenylate Cyclase
R-DME-5610787, Hedgehog 'off' state
R-DME-983231, Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
36041, 0 hits in 3 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
36041

Protein Ontology

More...
PROi
PR:P81900

Gene expression databases

BgeeiFBgn0022382, Expressed in central nervous system and 41 other tissues
GenevisibleiP81900, DM

Family and domain databases

CDDicd00038, CAP_ED, 2 hits
Gene3Di2.60.120.10, 2 hits
InterProiView protein in InterPro
IPR012198, cAMP_dep_PK_reg_su
IPR018490, cNMP-bd-like
IPR018488, cNMP-bd_CS
IPR000595, cNMP-bd_dom
IPR014710, RmlC-like_jellyroll
PfamiView protein in Pfam
PF00027, cNMP_binding, 2 hits
PIRSFiPIRSF000548, PK_regulatory, 1 hit
SMARTiView protein in SMART
SM00100, cNMP, 2 hits
SUPFAMiSSF51206, SSF51206, 2 hits
PROSITEiView protein in PROSITE
PS00888, CNMP_BINDING_1, 2 hits
PS00889, CNMP_BINDING_2, 2 hits
PS50042, CNMP_BINDING_3, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKAPR2_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P81900
Secondary accession number(s): A1A6P8
, A1A6T9, A2RVH2, A4UZA6, A8DY87, A8DY88, Q9NB18, Q9V5E8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: June 2, 2021
This is version 153 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again