Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cAMP-dependent protein kinase type II regulatory subunit

Gene

Pka-R2

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase. The regulatory subunit may play an essential role in the regulation of neuronal activity in the brain. Has a role in circadian locomotor rhythm, and behavioral response to cocaine and ethanol.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei189cAMP 1By similarity1
Binding sitei198cAMP 1By similarity1
Binding sitei311cAMP 2By similarity1
Binding sitei320cAMP 2By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi124 – 239cAMP 1Add BLAST116
Nucleotide bindingi242 – 362cAMP 2Add BLAST121

GO - Molecular functioni

GO - Biological processi

  • axon guidance Source: FlyBase
  • behavioral response to cocaine Source: UniProtKB
  • behavioral response to ethanol Source: UniProtKB
  • circadian rhythm Source: FlyBase
  • locomotor rhythm Source: UniProtKB
  • rhythmic behavior Source: FlyBase

Keywordsi

Biological processBiological rhythms
LigandcAMP, cAMP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-DME-163615 PKA activation
R-DME-164378 PKA activation in glucagon signalling
R-DME-180024 DARPP-32 events
R-DME-432040 Vasopressin regulates renal water homeostasis via Aquaporins
R-DME-5610787 Hedgehog 'off' state
R-DME-983231 Factors involved in megakaryocyte development and platelet production

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-dependent protein kinase type II regulatory subunit
Gene namesi
Name:Pka-R2
Synonyms:pka-RII
ORF Names:CG15862
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2R

Organism-specific databases

FlyBaseiFBgn0022382 Pka-R2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002053971 – 377cAMP-dependent protein kinase type II regulatory subunitAdd BLAST377

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei51Phosphoserine1 Publication1
Modified residuei58Phosphoserine1 Publication1
Modified residuei64Phosphoserine1 Publication1
Modified residuei67Phosphoserine1 Publication1
Modified residuei84Phosphoserine1 Publication1
Modified residuei90Phosphotyrosine1 Publication1

Post-translational modificationi

The pseudophosphorylation site binds to the substrate-binding region of the catalytic chain but is not phosphorylated. The physiological significance of phosphorylations by other kinases is unclear (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP81900
PRIDEiP81900

PTM databases

iPTMnetiP81900

Expressioni

Gene expression databases

BgeeiFBgn0022382
GenevisibleiP81900 DM

Interactioni

Subunit structurei

Tetramer, composed of 2 regulatory (R) and 2 catalytic (C) subunits. In the presence of cAMP it dissociates into 2 active monomeric C subunits and an R dimer (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Pka-C1P123704EBI-129349,EBI-82224

Protein-protein interaction databases

BioGridi61869, 8 interactors
IntActiP81900, 25 interactors
STRINGi7227.FBpp0087524

Structurei

3D structure databases

ProteinModelPortaliP81900
SMRiP81900
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi81 – 85Pseudophosphorylation motif5

Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1113 Eukaryota
COG0664 LUCA
GeneTreeiENSGT00530000062947
InParanoidiP81900
KOiK04739
OMAiILMESTF
OrthoDBiEOG091G0F1K
PhylomeDBiP81900

Family and domain databases

CDDicd00038 CAP_ED, 2 hits
Gene3Di2.60.120.10, 2 hits
InterProiView protein in InterPro
IPR012198 cAMP_dep_PK_reg_su
IPR018490 cNMP-bd-like
IPR018488 cNMP-bd_CS
IPR000595 cNMP-bd_dom
IPR014710 RmlC-like_jellyroll
PfamiView protein in Pfam
PF00027 cNMP_binding, 2 hits
PIRSFiPIRSF000548 PK_regulatory, 1 hit
SMARTiView protein in SMART
SM00100 cNMP, 2 hits
SUPFAMiSSF51206 SSF51206, 2 hits
PROSITEiView protein in PROSITE
PS00888 CNMP_BINDING_1, 2 hits
PS00889 CNMP_BINDING_2, 2 hits
PS50042 CNMP_BINDING_3, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform AImported (identifier: P81900-1) [UniParc]FASTAAdd to basket
Also known as: BImported

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSDSSRRIQ VPEELKEVLL QFSISFLVEQ PPDVIDYAVE YFTKLQSERP
60 70 80 90 100
SVSHTDQSTD DQLSVNSQDA DAEPPVMASS RRKSVFAEAY DPEADDDDDG
110 120 130 140 150
ATAVFPKTDE QRARLVESVK NVLLFRSLEK EQMNQVLDAM FERKVQPGDF
160 170 180 190 200
IIRQGDDGDN FYVIESGVYK VYINDKHINT YNHTGLFGEL ALLYNMPRAA
210 220 230 240 250
TVQAETSGLL WAMDRQTFRR ILLKSAFRKR KMYEELLNSV PMLKALQNYE
260 270 280 290 300
RMNLADALVS KSYDNGERII KQGDAADGMY FIEEGTVSVR MDQDDAEVEI
310 320 330 340 350
SQLGKGQYFG ELALVTHRPR AASVYATGGV VKLAFLDVKA FERLLGPCMD
360 370
IMKRNIDDYE SQLVKIFGSK NNITDTR
Length:377
Mass (Da):42,748
Last modified:September 13, 2004 - v2
Checksum:i26C9EF6562CCACCC
GO
Isoform EImported (identifier: P81900-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     339-340: KA → IC
     345-377: LGPCMDIMKRNIDDYESQLVKIFGSKNNITDTR → MGKCSGGIQRSISGYRYLEQDLREYFGNLPLN

Show »
Length:376
Mass (Da):42,615
Checksum:i0DA0E64CBF84896E
GO
Isoform DImported (identifier: P81900-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     338-377: VKAFERLLGP...GSKNNITDTR → TEAFERIMGF...TDMARRNTNL

Note: No experimental confirmation available.
Show »
Length:373
Mass (Da):42,426
Checksum:iA9E2BDADDA9F0C4A
GO

Sequence cautioni

The sequence ABL75628 differs from that shown.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_058165338 – 377VKAFE…ITDTR → TEAFERIMGFLTDVLKRNIV IYEQMFTDMARRNTNL in isoform D. CuratedAdd BLAST40
Alternative sequenceiVSP_026945339 – 340KA → IC in isoform E. 1 Publication2
Alternative sequenceiVSP_026946345 – 377LGPCM…ITDTR → MGKCSGGIQRSISGYRYLEQ DLREYFGNLPLN in isoform E. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274008 mRNA Translation: AAF86976.1
AE013599 Genomic DNA Translation: AAF58862.2
AE013599 Genomic DNA Translation: AAM71046.3
AE013599 Genomic DNA Translation: ABV53747.1
AE013599 Genomic DNA Translation: ABV53748.1
AY069669 mRNA Translation: AAL39814.1
BT029569 mRNA Translation: ABL75628.1 Sequence problems.
BT029610 mRNA Translation: ABL75669.1
BT029637 mRNA Translation: ABL75696.1
BT029963 mRNA Translation: ABM92837.1
RefSeqiNP_001097251.1, NM_001103781.3 [P81900-5]
NP_001097252.1, NM_001103782.2 [P81900-2]
NP_523671.1, NM_078947.4 [P81900-1]
NP_724860.2, NM_165723.4 [P81900-1]
UniGeneiDm.2017

Genome annotation databases

EnsemblMetazoaiFBtr0088437; FBpp0087523; FBgn0022382 [P81900-1]
FBtr0088438; FBpp0087524; FBgn0022382 [P81900-1]
FBtr0112901; FBpp0111814; FBgn0022382 [P81900-5]
FBtr0112902; FBpp0111815; FBgn0022382 [P81900-2]
GeneIDi36041
KEGGidme:Dmel_CG15862
UCSCiCG15862-RD d. melanogaster
CG15862-RE d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiKAPR2_DROME
AccessioniPrimary (citable) accession number: P81900
Secondary accession number(s): A1A6P8
, A1A6T9, A2RVH2, A4UZA6, A8DY87, A8DY88, Q9NB18, Q9V5E8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: September 13, 2004
Last modified: July 18, 2018
This is version 135 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health