UniProtKB - P81274 (GPSM2_HUMAN)

BLAST

>sp|P81274|GPSM2_HUMAN G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3
MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKT
LSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDE
AIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQA
AVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAA
ERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEK
AIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSG
ELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPE
KVQNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQR
KISADTIGDEGFFDLLSRFQSNRMDDQRCCLQEKNCHTASTTTSSTPPKMMLKTSSVPVV
SPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDI
LVKCQGSRLDDQRCAPPPATTKGPTVPDEDFFSLILRSQGKRMDEQRVLLQRDQNRDTDF
GLKDFLQNNALLEFKNSGKKSADH

Align
Format
Add to basket Added to basket
History
Entry version 191 (07 Nov 2018)
Sequence version 3 (20 Apr 2010)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

G-protein-signaling modulator 2

Gene

GPSM2

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Plays an important role in mitotic spindle pole organization via its interaction with NUMA1 (PubMed:11781568, PubMed:15632202, PubMed:21816348). Required for cortical dynein-dynactin complex recruitment during metaphase (PubMed:22327364). Plays a role in metaphase spindle orientation (PubMed:22327364). Plays also an important role in asymmetric cell divisions (PubMed:21816348). Has guanine nucleotide dissociation inhibitor (GDI) activity towards G(i) alpha proteins, such as GNAI1 and GNAI3, and thereby regulates their activity (By similarity).By similarity4 Publications

Miscellaneous

Dysfunction of LGN is associated with the phenotype of multiple micronuclei due to chromosomal mis-segregation and defect in cell division through mis-localization of mitotic spindle regulator protein NUMA1.Curated

Caution

It is uncertain whether Met-1 or Met-8 is the initiator.Curated

Mutations in GPSM2 have been identified in people with profound congenital non-syndromic deafness designated as DFNB82 (PubMed:20602914). Subsequent brain imaging of these individuals has revealed frontal polymicrogyria, abnormal corpus callosum, and gray matter heterotopia, consistent with a diagnosis of Chudley-McCullough syndrome (PubMed:22578326).2 Publications

Sites

Feature key	Position(s)	DescriptionActions	Length
Binding siteⁱ	608	GDP; shared with dimeric partnerBy similarity	1
Binding siteⁱ	613	GDP; shared with dimeric partnerBy similarity	1
Binding siteⁱ	642	GDP; shared with dimeric partnerBy similarity	1
Binding siteⁱ	647	GDP; shared with dimeric partnerBy similarity	1

GO - Molecular functionⁱ

dynein complex binding
Source: UniProtKB
Inferred from direct assayⁱ
- 22327364
GDP-dissociation inhibitor activity Source: UniProtKB
G-protein alpha-subunit binding Source: Ensembl
identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 15537540
nucleotide binding Source: UniProtKB-KW
protein C-terminus binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 22074847
protein domain specific binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 22074847
protein self-association
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22074847

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cell division Source: UniProtKB-KW
establishment of mitotic spindle orientation
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22327364
- 23870127
G protein-coupled receptor signaling pathway
Source: ProtInc
Traceable author statementⁱ
- 8973305
maintenance of centrosome location
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 21816348
mitotic spindle organization
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 21816348
positive regulation of protein localization to cell cortex
Source: UniProtKB
Inferred from mutant phenotypeⁱ
positive regulation of spindle assembly
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 11781568
Ran protein signal transduction
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22327364
regulation of mitotic spindle organization
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 23027904

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Cell cycle, Cell division, Mitosis, Transport
Ligand	Nucleotide-binding

Enzyme and pathway databases

Reactomeⁱ	R-HSA-418594 G alpha (i) signalling events
SIGNORⁱ	P81274

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: G-protein-signaling modulator 2 Alternative name(s): Mosaic protein LGN1 Publication
Gene namesⁱ	Name:GPSM2 Synonyms:LGN
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 1

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000121957.12
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:29501 GPSM2
MIMⁱ	609245 gene
neXtProtⁱ	NX_P81274

Keywords - Cellular componentⁱ

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Chudley-McCullough syndrome (CMCS)2 Publications

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionAn autosomal recessive neurologic disorder characterized by early-onset sensorineural deafness and specific brain anomalies on MRI, including hypoplasia of the corpus callosum, enlarged cysterna magna with mild focal cerebellar dysplasia, and nodular heterotopia. Some patients have hydrocephalus. Psychomotor development is normal.

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	228	R → A: Abolishes location at mitotic spindle poles; when associated with A-243. 1 Publication	1
Mutagenesisⁱ	228	R → E: Strongly reduces interaction with INSC. Abolishes interaction with INSC; when associated with R-290. 1 Publication	1
Mutagenesisⁱ	243	R → A: Abolishes location at mitotic spindle poles; when associated with A-228. 1 Publication	1
Mutagenesisⁱ	290	N → R: Abolishes interaction with INSC; when associated with E-228. 1 Publication	1

Keywords - Diseaseⁱ

Deafness

Organism-specific databases

DisGeNET More...DisGeNETⁱ	29899
MalaCards human disease database More...MalaCardsⁱ	GPSM2
MIMⁱ	604213 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000121957
Orphanetⁱ	90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB 314597 Chudley-McCullough syndrome
PharmGKBⁱ	PA134993615

Polymorphism and mutation databases

BioMutaⁱ	GPSM2
DMDMⁱ	294862507

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000106358	1 – 684	G-protein-signaling modulator 2Add BLAST		684

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	132	Phosphoserine; by PKGSequence analysis	1
Modified residueⁱ	352	Phosphoserine; by PKGSequence analysis	1
Modified residueⁱ	408	PhosphoserineCombined sources	1
Modified residueⁱ	483	PhosphoserineCombined sources	1
Modified residueⁱ	486	PhosphothreonineCombined sources	1
Modified residueⁱ	501	Phosphoserine; by PKCSequence analysis	1
Modified residueⁱ	541	PhosphoserineCombined sources	1
Modified residueⁱ	565	PhosphoserineCombined sources	1
Modified residueⁱ	607	Phosphoserine; by PKGSequence analysis	1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	P81274
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P81274
PaxDbⁱ	P81274
PeptideAtlas More...PeptideAtlasⁱ	P81274
PRIDEⁱ	P81274
ProteomicsDBⁱ	57693

PTM databases

iPTMnetⁱ	P81274
PhosphoSitePlusⁱ	P81274

Expressionⁱ

Tissue specificityⁱ

Ubiquitously expressed.

Gene expression databases

Bgeeⁱ	ENSG00000121957 Expressed in 222 organ(s), highest expression level in tibia
CleanExⁱ	HS_GPSM2
ExpressionAtlasⁱ	P81274 baseline and differential
Genevisibleⁱ	P81274 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB018962 HPA007327 HPA008408

HPAⁱ

CAB018962
HPA007327
HPA008408

Interactionⁱ

Subunit structureⁱ

Interacts with the dynein-dynactin complex; this interaction is inhibited in a PLK1-dependent manner (PubMed:22327364). Part of a spindle orientation complex at least composed of GNAI1, GPSM2 and NUMA1 (PubMed:26766442). Interacts with LLGL2 (PubMed:15632202). Interacts (via TPR repeat region) with INSC/inscuteable (PubMed:16458856, PubMed:22074847). Interacts (via TPR repeat region) with NUMA1 (via C-terminus); this interaction is direct, inhibited in a PLK1-dependent manner, prevents the binding of NUMA1 with SPAG5 and promotes spindle pole organization (PubMed:11781568, PubMed:22327364, PubMed:27462074). INSC and NUMA1 compete for the same binding site, but INSC has higher affinity and can displace NUMA1 (in vitro) (PubMed:22074847). Interacts with GNAI2 (PubMed:8973305). Interacts (via GoLoco domains) with the GDP-bound form of GNAI1 and GNAI3; has much lower affinity for the GTP-bound form. Interaction with GDP-bound GNAI3 strongly enhances the affinity for NUMA1 (By similarity). Interacts (via TPR repeat region) with FRMPD1 (PubMed:22074847). INSC and FRMPD1 compete for the same binding site, but INSC has higher affinity and can displace FRMPD1 (in vitro) (By similarity). Interacts (via TPR repeat region) with FRMPD4 (PubMed:22074847, PubMed:25664792). Identified in a complex with INSC and F2RL2/Par3 (PubMed:16458856).By similarity9 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
itself		7	EBI-618655,EBI-618655
GNAI1	P63096	3	EBI-618655,EBI-618639
NUMA1	Q14980	6	EBI-618655,EBI-521611

GO - Molecular functionⁱ

G-protein alpha-subunit binding Source: Ensembl
identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 15537540
protein C-terminus binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 22074847
protein domain specific binding
Source: UniProtKB
Inferred from physical interactionⁱ
- 22074847
protein self-association
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 22074847

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	118949, 15 interactors
CORUMⁱ	P81274
Database of interacting proteins More...DIPⁱ	DIP-399N
IntActⁱ	P81274, 18 interactors
Molecular INTeraction database More...MINTⁱ	P81274
STRINGⁱ	9606.ENSP00000264126

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	24 – 36	Combined sources	13
Helixⁱ	40 – 53	Combined sources	14
Helixⁱ	58 – 74	Combined sources	17
Helixⁱ	78 – 94	Combined sources	17
Helixⁱ	98 – 115	Combined sources	18
Helixⁱ	118 – 134	Combined sources	17
Helixⁱ	138 – 158	Combined sources	21
Helixⁱ	165 – 168	Combined sources	4
Helixⁱ	172 – 194	Combined sources	23
Helixⁱ	198 – 215	Combined sources	18
Helixⁱ	218 – 234	Combined sources	17
Helixⁱ	238 – 254	Combined sources	17
Helixⁱ	258 – 272	Combined sources	15
Helixⁱ	278 – 294	Combined sources	17
Helixⁱ	298 – 314	Combined sources	17
Helixⁱ	318 – 334	Combined sources	17
Helixⁱ	338 – 354	Combined sources	17
Helixⁱ	358 – 376	Combined sources	19

Show more details

3D structure databases

ProteinModelPortalⁱ	P81274
SMRⁱ	P81274
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Repeatⁱ	24 – 57	TPR 1Add BLAST	34
Repeatⁱ	62 – 95	TPR 2Add BLAST	34
Repeatⁱ	102 – 135	TPR 3Add BLAST	34
Repeatⁱ	142 – 184	TPR 4Add BLAST	43
Repeatⁱ	202 – 235	TPR 5Add BLAST	34
Repeatⁱ	242 – 275	TPR 6Add BLAST	34
Repeatⁱ	282 – 315	TPR 7Add BLAST	34
Repeatⁱ	322 – 355	TPR 8Add BLAST	34
Domainⁱ	489 – 511	GoLoco 1PROSITE-ProRule annotationAdd BLAST	23
Domainⁱ	544 – 566	GoLoco 2PROSITE-ProRule annotationAdd BLAST	23
Domainⁱ	594 – 616	GoLoco 3PROSITE-ProRule annotationAdd BLAST	23
Domainⁱ	628 – 650	GoLoco 4PROSITE-ProRule annotationAdd BLAST	23

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	22 – 357	Important for interaction with NUMA1; INSC and FRMPD1By similarityAdd BLAST		336

Sequence similaritiesⁱ

Belongs to the GPSM family.Curated

Keywords - Domainⁱ

Repeat, TPR repeat

Phylogenomic databases

eggNOGⁱ	KOG1130 Eukaryota ENOG410XP6N LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063126
HOGENOMⁱ	HOG000231543
HOVERGENⁱ	HBG051823
InParanoidⁱ	P81274
KEGG Orthology (KO) More...KOⁱ	K15837
OMAⁱ	MLKTPSV
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G04C9
PhylomeDBⁱ	P81274
TreeFamⁱ	TF328344

Family and domain databases

Gene3Dⁱ	1.25.40.10, 3 hits
InterProⁱ	View protein in InterPro IPR003109 GoLoco_motif IPR013026 TPR-contain_dom IPR011990 TPR-like_helical_dom_sf IPR019734 TPR_repeat
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02188 GoLoco, 4 hits PF13176 TPR_7, 2 hits PF13181 TPR_8, 1 hit
SMARTⁱ	View protein in SMART SM00390 GoLoco, 4 hits SM00028 TPR, 7 hits
SUPFAMⁱ	SSF48452 SSF48452, 2 hits
PROSITEⁱ	View protein in PROSITE PS50877 GOLOCO, 4 hits PS50005 TPR, 6 hits PS50293 TPR_REGION, 2 hits

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 8 potential isoforms that are computationally mapped.Show all Align All

P81274-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MEENLISMRE DHSFHVRYRM EASCLELALE GERLCKSGDC RAGVSFFEAA 
        60         70         80         90        100
VQVGTEDLKT LSAIYSQLGN AYFYLHDYAK ALEYHHHDLT LARTIGDQLG 
       110        120        130        140        150
EAKASGNLGN TLKVLGNFDE AIVCCQRHLD ISRELNDKVG EARALYNLGN 
       160        170        180        190        200
VYHAKGKSFG CPGPQDVGEF PEEVRDALQA AVDFYEENLS LVTALGDRAA 
       210        220        230        240        250
QGRAFGNLGN THYLLGNFRD AVIAHEQRLL IAKEFGDKAA ERRAYSNLGN 
       260        270        280        290        300
AYIFLGEFET ASEYYKKTLL LARQLKDRAV EAQSCYSLGN TYTLLQDYEK 
       310        320        330        340        350
AIDYHLKHLA IAQELNDRIG EGRACWSLGN AYTALGNHDQ AMHFAEKHLE 
       360        370        380        390        400
ISREVGDKSG ELTARLNLSD LQMVLGLSYS TNNSIMSENT EIDSSLNGVR 
       410        420        430        440        450
PKLGRRHSME NMELMKLTPE KVQNWNSEIL AKQKPLIAKP SAKLLFVNRL 
       460        470        480        490        500
KGKKYKTNSS TKVLQDASNS IDHRIPNSQR KISADTIGDE GFFDLLSRFQ 
       510        520        530        540        550
SNRMDDQRCC LQEKNCHTAS TTTSSTPPKM MLKTSSVPVV SPNTDEFLDL 
       560        570        580        590        600
LASSQSRRLD DQRASFSNLP GLRLTQNSQS VLSHLMTNDN KEADEDFFDI 
       610        620        630        640        650
LVKCQGSRLD DQRCAPPPAT TKGPTVPDED FFSLILRSQG KRMDEQRVLL 
       660        670        680 
QRDQNRDTDF GLKDFLQNNA LLEFKNSGKK SADH

Length:684

Mass (Da):76,662

Last modified:April 20, 2010 - v3

Checksum:ⁱD007A4765F57CB90

Computationally mapped potential isoform sequencesⁱ

There are 8 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q5T1N9	Q5T1N9_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	213	Annotation score:
H0Y4A4	H0Y4A4_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	217	Annotation score:
A0A2R8Y6E3	A0A2R8Y6E3_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	311	Annotation score:
B0QZC9	B0QZC9_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	52	Annotation score:
B0QZD0	B0QZD0_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	75	Annotation score:
A0A2R8YCX1	A0A2R8YCX1_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	228	Annotation score:
A0A2R8Y896	A0A2R8Y896_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	83	Annotation score:
A0A2R8Y673	A0A2R8Y673_HUMAN	G-protein-signaling modulator 2 G-protein-signaling modulator 2	GPSM2	93	Annotation score:

Sequence cautionⁱ

The sequence AAB40385 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

The sequence AAH27732 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	400	R → L in AAB40385 (PubMed:8973305).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U54999 mRNA Translation: AAB40385.1 Different initiation. AB445462 mRNA Translation: BAH84760.1 AL449266 Genomic DNA No translation available. CH471122 Genomic DNA Translation: EAW56340.1 BC027732 mRNA Translation: AAH27732.1 Different initiation. AY136740 mRNA Translation: AAN01266.1 CR456786 mRNA Translation: CAG33067.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS792.2
PIRⁱ	JC5334 G02540
NCBI Reference Sequences More...RefSeqⁱ	NP_001307967.1, NM_001321038.1 NP_001307968.1, NM_001321039.1 NP_037428.3, NM_013296.4 XP_011539603.1, XM_011541301.2 XP_011539604.1, XM_011541302.2 XP_016856586.1, XM_017001097.1 XP_016856587.1, XM_017001098.1
UniGeneⁱ	Hs.584901 Hs.658489

Genome annotation databases

Ensemblⁱ	ENST00000264126; ENSP00000264126; ENSG00000121957 ENST00000406462; ENSP00000385510; ENSG00000121957 ENST00000642355; ENSP00000496104; ENSG00000121957
GeneIDⁱ	29899
KEGGⁱ	hsa:29899
UCSC genome browser More...UCSCⁱ	uc010ovc.3 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P81274	G-protein signalling modulator 2 (AGS3-like, C. elegans), isoform CRA_a		HUMAN		684	UniRef100_P81274
GPSM2 isoform 4 (Fragment)		PANTR		213
G-protein-signaling modulator 2 (Fragment)		HUMAN		213
UPI0000E05738		HUMAN		665

Protein	Similar proteins		Species	Score	Length	Source
P81274	G-protein signalling modulator 2 (AGS3-like, C. elegans), isoform CRA_a		HUMAN		684	UniRef90_P81274
GPSM2 isoform 4 (Fragment)		PANTR		213
Uncharacterized protein		MACFA		686
G-protein-signaling modulator 2		MACMU		686
G-protein-signaling modulator 2 isoform X1		Enhydra lutris kenyoni		686
+159

Protein	Similar proteins		Species	Score	Length	Source
P81274	G-protein-signaling modulator 2	)	MOUSE		679	UniRef50_P81274
G-protein signalling modulator 2 (AGS3-like, C. elegans), isoform CRA_a		HUMAN		684
GPSM2 isoform 4 (Fragment)		PANTR		213
Uncharacterized protein		MACFA		686
Uncharacterized protein		MACMU		686
+922

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U54999 mRNA Translation: AAB40385.1 Different initiation. AB445462 mRNA Translation: BAH84760.1 AL449266 Genomic DNA No translation available. CH471122 Genomic DNA Translation: EAW56340.1 BC027732 mRNA Translation: AAH27732.1 Different initiation. AY136740 mRNA Translation: AAN01266.1 CR456786 mRNA Translation: CAG33067.1
CCDSⁱ	CCDS792.2
PIRⁱ	JC5334 G02540
RefSeqⁱ	NP_001307967.1, NM_001321038.1 NP_001307968.1, NM_001321039.1 NP_037428.3, NM_013296.4 XP_011539603.1, XM_011541301.2 XP_011539604.1, XM_011541302.2 XP_016856586.1, XM_017001097.1 XP_016856587.1, XM_017001098.1
UniGeneⁱ	Hs.584901 Hs.658489

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3SF4	X-ray	2.60	A/B/C	20-421	[»]
	4WND	X-ray	1.50	A	20-421	[»]
	4WNE	X-ray	2.00	A	20-421	[»]
	4WNF	X-ray	2.90	A	20-421	[»]
	4WNG	X-ray	2.11	A	20-421	[»]
	5A6C	X-ray	2.90	A/B	22-357	[»]
ProteinModelPortalⁱ	P81274
SMRⁱ	P81274
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	118949, 15 interactors
CORUMⁱ	P81274
DIPⁱ	DIP-399N
IntActⁱ	P81274, 18 interactors
MINTⁱ	P81274
STRINGⁱ	9606.ENSP00000264126

PTM databases

iPTMnetⁱ	P81274
PhosphoSitePlusⁱ	P81274

Polymorphism and mutation databases

BioMutaⁱ	GPSM2
DMDMⁱ	294862507

Proteomic databases

EPDⁱ	P81274
MaxQBⁱ	P81274
PaxDbⁱ	P81274
PeptideAtlasⁱ	P81274
PRIDEⁱ	P81274
ProteomicsDBⁱ	57693

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	29899
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000264126; ENSP00000264126; ENSG00000121957 ENST00000406462; ENSP00000385510; ENSG00000121957 ENST00000642355; ENSP00000496104; ENSG00000121957
GeneIDⁱ	29899
KEGGⁱ	hsa:29899
UCSCⁱ	uc010ovc.3 human

Organism-specific databases

CTDⁱ	29899
DisGeNETⁱ	29899
EuPathDBⁱ	HostDB:ENSG00000121957.12
GeneCardsⁱ	GPSM2
HGNCⁱ	HGNC:29501 GPSM2
HPAⁱ	CAB018962 HPA007327 HPA008408
MalaCardsⁱ	GPSM2
MIMⁱ	604213 phenotype 609245 gene
neXtProtⁱ	NX_P81274
OpenTargetsⁱ	ENSG00000121957
Orphanetⁱ	90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB 314597 Chudley-McCullough syndrome
PharmGKBⁱ	PA134993615
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1130 Eukaryota ENOG410XP6N LUCA
GeneTreeⁱ	ENSGT00530000063126
HOGENOMⁱ	HOG000231543
HOVERGENⁱ	HBG051823
InParanoidⁱ	P81274
KOⁱ	K15837
OMAⁱ	MLKTPSV
OrthoDBⁱ	EOG091G04C9
PhylomeDBⁱ	P81274
TreeFamⁱ	TF328344

Enzyme and pathway databases

Reactomeⁱ	R-HSA-418594 G alpha (i) signalling events
SIGNORⁱ	P81274

Miscellaneous databases

GeneWikiⁱ	GPSM2
GenomeRNAiⁱ	29899
Protein Ontology More...PROⁱ	PR:P81274
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000121957 Expressed in 222 organ(s), highest expression level in tibia
CleanExⁱ	HS_GPSM2
ExpressionAtlasⁱ	P81274 baseline and differential
Genevisibleⁱ	P81274 HS

Family and domain databases

Gene3Dⁱ	1.25.40.10, 3 hits
InterProⁱ	View protein in InterPro IPR003109 GoLoco_motif IPR013026 TPR-contain_dom IPR011990 TPR-like_helical_dom_sf IPR019734 TPR_repeat
Pfamⁱ	View protein in Pfam PF02188 GoLoco, 4 hits PF13176 TPR_7, 2 hits PF13181 TPR_8, 1 hit
SMARTⁱ	View protein in SMART SM00390 GoLoco, 4 hits SM00028 TPR, 7 hits
SUPFAMⁱ	SSF48452 SSF48452, 2 hits
PROSITEⁱ	View protein in PROSITE PS50877 GOLOCO, 4 hits PS50005 TPR, 6 hits PS50293 TPR_REGION, 2 hits
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	GPSM2_HUMAN
Accessionⁱ	P81274Primary (citable) accession number: P81274 Secondary accession number(s): Q5T1N8, Q6IBL7, Q8N0Z5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 30, 2000
	Last sequence update:	April 20, 2010
	Last modified:	November 7, 2018
	This is version 191 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 1
Human chromosome 1: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P81274 (GPSM2_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

G-protein-signaling modulator 2

GPSM2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

Caution

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytoskeleton

Plasma membrane

Other locations

Cytoskeleton

Cytosol

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Keywords - Diseasei

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ