UniProtKB - P80386 (AAKB1_RAT)

BLAST

>sp|P80386|AAKB1_RAT 5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Prkab1 PE=1 SV=4
MGNTSSERAALERQAGHKTPRRDSSGGTKDGDRPKILMDSPEDADIFHTEEMKAPEKEEF
LAWQHDLEVNEKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYISKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Align
Format
Add to basket Added to basket
History
Entry version 170 (10 Oct 2018)
Sequence version 4 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

5'-AMP-activated protein kinase subunit beta-1

Gene

Prkab1

Organism

Rattus norvegicus (Rat)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).

GO - Molecular functionⁱ

protein kinase activity Source: Ensembl
protein kinase binding
Source: RGD
Inferred from physical interactionⁱ
- 15695819
- 16648175

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

fatty acid biosynthetic process Source: UniProtKB-KW
nail development Source: Ensembl
positive regulation of cold-induced thermogenesis
Source: YuBioLab
Inferred from sequence or structural similarityⁱ
- 27411013
positive regulation of gene expression Source: Ensembl
protein heterooligomerization
Source: RGD
Inferred from direct assayⁱ
- 14511394
regulation of catalytic activity
Source: RGD
Inferred from direct assayⁱ
- 15695819

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism

Biological process

Fatty acid biosynthesis, Fatty acid metabolism, Lipid biosynthesis, Lipid metabolism

Enzyme and pathway databases

BRENDAⁱ	2.7.11.31 5301
Reactomeⁱ	R-RNO-1632852 Macroautophagy R-RNO-380972 Energy dependent regulation of mTOR by LKB1-AMPK R-RNO-5628897 TP53 Regulates Metabolic Genes R-RNO-6804756 Regulation of TP53 Activity through Phosphorylation

Protein family/group databases

Carbohydrate-Active enZymes More...CAZyⁱ	CBM48 Carbohydrate-Binding Module Family 48

CAZyⁱ

CBM48 Carbohydrate-Binding Module Family 48

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 5'-AMP-activated protein kinase subunit beta-1 Short name: AMPK subunit beta-1 Short name: AMPKb Alternative name(s): 5'-AMP-activated protein kinase 40 kDa subunit
Gene namesⁱ	Name:Prkab1
Organismⁱ	Rattus norvegicus (Rat)
Taxonomic identifierⁱ	10116 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Rattus
Proteomesⁱ	UP000002494 Componentⁱ: Chromosome 12

Organism-specific databases

Rat genome database More...RGDⁱ	71057 Prkab1

RGDⁱ

71057 Prkab1

Subcellular locationⁱ

GO - Cellular component

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	100	W → G: Abolishes glycogen-binding. 1 Publication	1
Mutagenesisⁱ	100	W → L: Partially inhibits glycogen-binding. 1 Publication	1
Mutagenesisⁱ	126	K → Q: Abolishes glycogen-binding. 1 Publication	1
Mutagenesisⁱ	146	L → A: Significantly reduces glycogen-binding. 1 Publication	1
Mutagenesisⁱ	150	N → K: Abolishes glycogen-binding. 1 Publication	1
Mutagenesisⁱ	150	N → Q: Significantly reduces glycogen-binding. 1 Publication	1

Chemistry databases

ChEMBLⁱ	CHEMBL3885503

ChEMBLⁱ

CHEMBL3885503

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed
ChainⁱPRO_0000204367	2 – 270	5'-AMP-activated protein kinase subunit beta-1Add BLAST		269

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Lipidationⁱ	2	N-myristoyl glycine2 Publications	1
Modified residueⁱ	4	PhosphothreonineBy similarity	1
Modified residueⁱ	5	PhosphoserineBy similarity	1
Modified residueⁱ	6	PhosphoserineBy similarity	1
Modified residueⁱ	19	PhosphothreonineBy similarity	1
Modified residueⁱ	24	Phosphoserine; by autocatalysis2 Publications	1
Modified residueⁱ	25	Phosphoserine; by autocatalysis2 Publications	1
Modified residueⁱ	40	PhosphoserineCombined sources	1
Modified residueⁱ	96	Phosphoserine1 Publication	1
Modified residueⁱ	101	Phosphoserine1 Publication	1
Modified residueⁱ	108	Phosphoserine; by autocatalysisCombined sources3 Publications	1
Modified residueⁱ	148	PhosphothreonineBy similarity	1
Modified residueⁱ	182	Phosphoserine2 Publications	1
Modified residueⁱ	201	N6-succinyllysineBy similarity	1

Post-translational modificationⁱ

Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1 and AMPK.4 Publications

Keywords - PTMⁱ

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

PaxDbⁱ	P80386
PRIDEⁱ	P80386

PTM databases

iPTMnetⁱ	P80386
PhosphoSitePlusⁱ	P80386

Expressionⁱ

Tissue specificityⁱ

Highly expressed in kidney, heart, white adipose tissue, lung and spleen.

Gene expression databases

Bgeeⁱ	ENSRNOG00000001142 Expressed in 10 organ(s), highest expression level in heart
Genevisibleⁱ	P80386 RN

Interactionⁱ

Subunit structureⁱ

AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non-catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2.1 Publication

GO - Molecular functionⁱ

protein kinase binding
Source: RGD
Inferred from physical interactionⁱ
- 15695819
- 16648175

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	249839, 1 interactor
Database of interacting proteins More...DIPⁱ	DIP-59127N
IntActⁱ	P80386, 178 interactors
STRINGⁱ	10116.ENSRNOP00000001508

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	78 – 84	Combined sources	7
Beta strandⁱ	91 – 95	Combined sources	5
Helixⁱ	96 – 98	Combined sources	3
Beta strandⁱ	102 – 104	Combined sources	3
Beta strandⁱ	106 – 108	Combined sources	3
Beta strandⁱ	111 – 118	Combined sources	8
Beta strandⁱ	120 – 129	Combined sources	10
Beta strandⁱ	132 – 134	Combined sources	3
Beta strandⁱ	141 – 143	Combined sources	3
Beta strandⁱ	149 – 155	Combined sources	7
Turnⁱ	158 – 160	Combined sources	3
Beta strandⁱ	161 – 163	Combined sources	3
Helixⁱ	164 – 170	Combined sources	7
Helixⁱ	208 – 211	Combined sources	4
Turnⁱ	214 – 216	Combined sources	3
Beta strandⁱ	225 – 227	Combined sources	3
Helixⁱ	233 – 235	Combined sources	3
Beta strandⁱ	240 – 245	Combined sources	6
Beta strandⁱ	248 – 257	Combined sources	10
Beta strandⁱ	260 – 269	Combined sources	10

Show more details

3D structure databases

ProteinModelPortalⁱ	P80386
SMRⁱ	P80386
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P80386

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	68 – 163	Glycogen-binding domainAdd BLAST		96

Domainⁱ

The glycogen-binding domain may target AMPK to glycogen so that other factors like glycogen-bound debranching enzyme or protein phosphatases can directly affect AMPK activity.1 Publication

Sequence similaritiesⁱ

Belongs to the 5'-AMP-activated protein kinase beta subunit family.Curated

Phylogenomic databases

eggNOGⁱ	KOG1616 Eukaryota ENOG410XRB3 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000001416
HOGENOMⁱ	HOG000230597
HOVERGENⁱ	HBG050430
InParanoidⁱ	P80386
KEGG Orthology (KO) More...KOⁱ	K07199
OMAⁱ	KCSDMSE
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0DZR
PhylomeDBⁱ	P80386
TreeFamⁱ	TF313827

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR032640 AMPK1_CBM IPR039160 AMPKB IPR006828 ASC_dom IPR037256 ASC_dom_sf IPR013783 Ig-like_fold IPR014756 Ig_E-set
PANTHERⁱ	PTHR10343:SF80 PTHR10343:SF80, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF16561 AMPK1_CBM, 1 hit PF04739 AMPKBI, 1 hit
SMARTⁱ	View protein in SMART SM01010 AMPKBI, 1 hit
SUPFAMⁱ	SSF160219 SSF160219, 1 hit SSF81296 SSF81296, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P80386-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MGNTSSERAA LERQAGHKTP RRDSSGGTKD GDRPKILMDS PEDADIFHTE 
        60         70         80         90        100
EMKAPEKEEF LAWQHDLEVN EKAPAQARPT VFRWTGGGKE VYLSGSFNNW 
       110        120        130        140        150
SKLPLTRSQN NFVAILDLPE GEHQYKFFVD GQWTHDPSEP IVTSQLGTVN 
       160        170        180        190        200
NIIQVKKTDF EVFDALMVDS QKCSDVSELS SSPPGPYHQE PYISKPEERF 
       210        220        230        240        250
KAPPILPPHL LQVILNKDTG ISCDPALLPE PNHVMLNHLY ALSIKDGVMV 
       260        270
LSATHRYKKK YVTTLLYKPI

Length:270

Mass (Da):30,394

Last modified:January 23, 2007 - v4

Checksum:ⁱ62726DD357F36C7C

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	26	G → E in AAC52579 (PubMed:8621499).Curated		1
Sequence conflictⁱ	52	M → I AA sequence (PubMed:7961907).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U42411 mRNA Translation: AAC52579.1 BC062008 mRNA Translation: AAH62008.1 X95577 mRNA Translation: CAA64830.1
NCBI Reference Sequences More...RefSeqⁱ	NP_114182.1, NM_031976.1 XP_006249543.1, XM_006249481.3
UniGeneⁱ	Rn.3619

Genome annotation databases

Ensemblⁱ	ENSRNOT00000001508; ENSRNOP00000001508; ENSRNOG00000001142
GeneIDⁱ	83803
KEGGⁱ	rno:83803
UCSC genome browser More...UCSCⁱ	RGD:71057 rat

Protein	Similar proteins		Species	Score	Length	Source
P80386	5'-AMP-activated protein kinase subunit beta-1		MOUSE		270	UniRef90_P80386
5'-AMP-activated protein kinase subunit beta-1		PONAB		270
5'-AMP-activated protein kinase subunit beta-1		BOVIN		270
5'-AMP-activated protein kinase subunit beta-1 (Fragment)		PIG		122
5'-AMP-activated protein kinase subunit beta-1		yellow-throated sandgrouse		275
+180

Protein	Similar proteins		Species	Score	Length	Source
P80386	5'-AMP-activated protein kinase subunit beta-1		MOUSE		270	UniRef50_P80386
5'-AMP-activated protein kinase subunit beta-1		PONAB		270
5'-AMP-activated protein kinase subunit beta-1		BOVIN		270
5'-AMP-activated protein kinase subunit beta-1 (Fragment)		PIG		122
5'-AMP-activated protein kinase subunit beta-2	)	RAT		271
+276

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U42411 mRNA Translation: AAC52579.1 BC062008 mRNA Translation: AAH62008.1 X95577 mRNA Translation: CAA64830.1
RefSeqⁱ	NP_114182.1, NM_031976.1 XP_006249543.1, XM_006249481.3
UniGeneⁱ	Rn.3619

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1Z0M	X-ray	1.91	A/B/C	68-163	[»]
	1Z0N	X-ray	1.49	A/B/C	68-163	[»]
	4EAG	X-ray	2.70	B	187-270	[»]
	4EAK	X-ray	2.50	B	200-270	[»]
	4EAL	X-ray	2.51	B	200-270	[»]
	4QFG	X-ray	3.46	B	68-270	[»]
	4QFR	X-ray	3.34	B	68-270	[»]
	4QFS	X-ray	3.55	B	68-270	[»]
	4YEF	X-ray	1.72	A/B/C/D/E/F/G	76-156	[»]
	5KQ5	X-ray	3.41	B	68-270	[»]
	5T5T	X-ray	3.46	B	68-270	[»]
	5UFU	X-ray	3.45	B	67-270	[»]
	6E4T	X-ray	3.40	B	67-270	[»]
	6E4U	X-ray	3.27	B	67-270	[»]
	6E4W	X-ray	3.35	B	67-270	[»]
ProteinModelPortalⁱ	P80386
SMRⁱ	P80386
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	249839, 1 interactor
DIPⁱ	DIP-59127N
IntActⁱ	P80386, 178 interactors
STRINGⁱ	10116.ENSRNOP00000001508

Chemistry databases

ChEMBLⁱ	CHEMBL3885503

ChEMBLⁱ

CHEMBL3885503

Protein family/group databases

CAZyⁱ	CBM48 Carbohydrate-Binding Module Family 48

CAZyⁱ

CBM48 Carbohydrate-Binding Module Family 48

PTM databases

iPTMnetⁱ	P80386
PhosphoSitePlusⁱ	P80386

Proteomic databases

PaxDbⁱ	P80386
PRIDEⁱ	P80386

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	83803
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENSRNOT00000001508; ENSRNOP00000001508; ENSRNOG00000001142
GeneIDⁱ	83803
KEGGⁱ	rno:83803
UCSCⁱ	RGD:71057 rat

Organism-specific databases

CTDⁱ	5564
RGDⁱ	71057 Prkab1

Phylogenomic databases

eggNOGⁱ	KOG1616 Eukaryota ENOG410XRB3 LUCA
GeneTreeⁱ	ENSGT00390000001416
HOGENOMⁱ	HOG000230597
HOVERGENⁱ	HBG050430
InParanoidⁱ	P80386
KOⁱ	K07199
OMAⁱ	KCSDMSE
OrthoDBⁱ	EOG091G0DZR
PhylomeDBⁱ	P80386
TreeFamⁱ	TF313827

Enzyme and pathway databases

BRENDAⁱ	2.7.11.31 5301
Reactomeⁱ	R-RNO-1632852 Macroautophagy R-RNO-380972 Energy dependent regulation of mTOR by LKB1-AMPK R-RNO-5628897 TP53 Regulates Metabolic Genes R-RNO-6804756 Regulation of TP53 Activity through Phosphorylation

Miscellaneous databases

EvolutionaryTraceⁱ	P80386
Protein Ontology More...PROⁱ	PR:P80386

Gene expression databases

Bgeeⁱ	ENSRNOG00000001142 Expressed in 10 organ(s), highest expression level in heart
Genevisibleⁱ	P80386 RN

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR032640 AMPK1_CBM IPR039160 AMPKB IPR006828 ASC_dom IPR037256 ASC_dom_sf IPR013783 Ig-like_fold IPR014756 Ig_E-set
PANTHERⁱ	PTHR10343:SF80 PTHR10343:SF80, 1 hit
Pfamⁱ	View protein in Pfam PF16561 AMPK1_CBM, 1 hit PF04739 AMPKBI, 1 hit
SMARTⁱ	View protein in SMART SM01010 AMPKBI, 1 hit
SUPFAMⁱ	SSF160219 SSF160219, 1 hit SSF81296 SSF81296, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	AAKB1_RAT
Accessionⁱ	P80386Primary (citable) accession number: P80386 Secondary accession number(s): Q63048
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 1, 1995
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 170 of the entry and version 4 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P80386 (AAKB1_RAT)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

5'-AMP-activated protein kinase subunit beta-1

Prkab1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Chemistry databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Protein family/group databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ