Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Double-stranded RNA-specific editase 1

Gene

ADARB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2 and GRIK2) and serotonin (HTR2C), GABA receptor (GABRA3) and potassium voltage-gated channel (KCNA1). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alter their functional activities. Edits GRIA2 at both the Q/R and R/G sites efficiently but converts the adenosine in hotspot1 much less efficiently. Can exert a proviral effect towards human immunodeficiency virus type 1 (HIV-1) and enhances its replication via both an editing-dependent and editing-independent mechanism. The former involves editing of adenosines in the 5'UTR while the latter occurs via suppression of EIF2AK2/PKR activation and function. Can inhibit cell proliferation and migration and can stimulate exocytosis.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

1D-myo-inositol hexakisphosphateNote: Binds 1 myo-inositol hexakisphosphate (IP6) per subunit.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi394Zinc1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei396Proton donor1
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei400Inositol hexakisphosphate1
Binding sitei401Inositol hexakisphosphate1
Metal bindingi451Zinc1
Metal bindingi556Zinc1
Binding sitei559Inositol hexakisphosphate1
Binding sitei562Inositol hexakisphosphate1
Binding sitei669Inositol hexakisphosphate1
Binding sitei702Inositol hexakisphosphate1
Binding sitei712Inositol hexakisphosphate1
Binding sitei730Inositol hexakisphosphate1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • double-stranded RNA adenosine deaminase activity Source: HGNC
  • double-stranded RNA binding Source: HGNC
  • metal ion binding Source: UniProtKB-KW
  • mRNA binding Source: BHF-UCL
  • RNA binding Source: UniProtKB
  • tRNA-specific adenosine deaminase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, RNA-binding
Biological processAntiviral defense, Immunity, Innate immunity, mRNA processing
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.5.4.37 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-75102 C6 deamination of adenosine
R-HSA-77042 Formation of editosomes by ADAR proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Double-stranded RNA-specific editase 1 (EC:3.5.4.37)
Alternative name(s):
RNA-editing deaminase 1
RNA-editing enzyme 1
dsRNA adenosine deaminase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADARB1
Synonyms:ADAR2, DRADA2, RED1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000197381.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:226 ADARB1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601218 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78563

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
104

Open Targets

More...
OpenTargetsi
ENSG00000197381

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24556

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADARB1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2829669

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001717791 – 741Double-stranded RNA-specific editase 1Add BLAST741

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26PhosphoserineCombined sources1
Modified residuei149PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P78563

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78563

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P78563

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78563

PeptideAtlas

More...
PeptideAtlasi
P78563

PRoteomics IDEntifications database

More...
PRIDEi
P78563

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57656
57657 [P78563-2]
57658 [P78563-3]
57659 [P78563-4]
57660 [P78563-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P78563

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78563

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in brain and heart and at lower levels in placenta. Fair expression in lung, liver and kidney. Detected in brain, heart, kidney, lung and liver (at protein level). Isoform 5 is high expressed in hippocampus and colon. Isoform 5 is expressed in pediatric astrocytomas and the protein has a decreased RNA-editing activity. The decrease in RNA editing correlates with the grade of malignancy of the tumors, with the high grade tumors showing lower editing is seen.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000197381 Expressed in 224 organ(s), highest expression level in esophagus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P78563 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78563 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029645

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Homodimerization is essential for its catalytic activity. Can form heterodimers with isoform 5 of ADAR/ADAR1.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106618, 66 interactors

Protein interaction database and analysis system

More...
IntActi
P78563, 22 interactors

Molecular INTeraction database

More...
MINTi
P78563

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000353920

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1741
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZY7X-ray1.70A/B299-741[»]
5ED1X-ray2.77A/D299-741[»]
5ED2X-ray2.95A/D299-741[»]
5HP2X-ray2.98A/D299-741[»]
5HP3X-ray3.09A/D299-741[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P78563

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P78563

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P78563

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini78 – 144DRBM 1PROSITE-ProRule annotationAdd BLAST67
Domaini231 – 298DRBM 2PROSITE-ProRule annotationAdd BLAST68
Domaini370 – 737A to I editasePROSITE-ProRule annotationAdd BLAST368

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni83 – 88Interaction with substrate RNABy similarity6
Regioni104 – 105Interaction with substrate RNABy similarity2
Regioni237 – 242Interaction with substrate RNABy similarity6
Regioni259Interaction with substrate RNABy similarity1

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2777 Eukaryota
ENOG410XT0Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155992

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000213660

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG003836

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78563

KEGG Orthology (KO)

More...
KOi
K13194

Identification of Orthologs from Complete Genome Data

More...
OMAi
DNVQFHL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78563

TreeFam database of animal gene trees

More...
TreeFami
TF315806

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00048 DSRM, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002466 A_deamin
IPR014720 dsRBD_dom
IPR008996 IL1/FGF

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02137 A_deamin, 1 hit
PF00035 dsrm, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00552 ADEAMc, 1 hit
SM00358 DSRM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50353 SSF50353, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50141 A_DEAMIN_EDITASE, 1 hit
PS50137 DS_RBD, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78563-1) [UniParc]FASTAAdd to basket
Also known as: RED1-L, DRADA2B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDIEDEENMS SSSTDVKENR NLDNVSPKDG STPGPGEGSQ LSNGGGGGPG
60 70 80 90 100
RKRPLEEGSN GHSKYRLKKR RKTPGPVLPK NALMQLNEIK PGLQYTLLSQ
110 120 130 140 150
TGPVHAPLFV MSVEVNGQVF EGSGPTKKKA KLHAAEKALR SFVQFPNASE
160 170 180 190 200
AHLAMGRTLS VNTDFTSDQA DFPDTLFNGF ETPDKAEPPF YVGSNGDDSF
210 220 230 240 250
SSSGDLSLSA SPVPASLAQP PLPVLPPFPP PSGKNPVMIL NELRPGLKYD
260 270 280 290 300
FLSESGESHA KSFVMSVVVD GQFFEGSGRN KKLAKARAAQ SALAAIFNLH
310 320 330 340 350
LDQTPSRQPI PSEGLQLHLP QVLADAVSRL VLGKFGDLTD NFSSPHARRK
360 370 380 390 400
VLAGVVMTTG TDVKDAKVIS VSTGTKCING EYMSDRGLAL NDCHAEIISR
410 420 430 440 450
RSLLRFLYTQ LELYLNNKDD QKRSIFQKSE RGGFRLKENV QFHLYISTSP
460 470 480 490 500
CGDARIFSPH EPILEGSRSY TQAGVQWCNH GSLQPRPPGL LSDPSTSTFQ
510 520 530 540 550
GAGTTEPADR HPNRKARGQL RTKIESGEGT IPVRSNASIQ TWDGVLQGER
560 570 580 590 600
LLTMSCSDKI ARWNVVGIQG SLLSIFVEPI YFSSIILGSL YHGDHLSRAM
610 620 630 640 650
YQRISNIEDL PPLYTLNKPL LSGISNAEAR QPGKAPNFSV NWTVGDSAIE
660 670 680 690 700
VINATTGKDE LGRASRLCKH ALYCRWMRVH GKVPSHLLRS KITKPNVYHE
710 720 730 740
SKLAAKEYQA AKARLFTAFI KAGLGAWVEK PTEQDQFSLT P
Note: Alu insert from position 465 to 505. Has a lower catalytic activity than isoform 2. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:741
Mass (Da):80,763
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i02B583414DD59C20
GO
Isoform 2 (identifier: P78563-2) [UniParc]FASTAAdd to basket
Also known as: ADAR2a, DRADA2A, RED1-S

The sequence of this isoform differs from the canonical sequence as follows:
     466-505: Missing.

Note: Has a higher catalytic activity than isoform 1.
Show »
Length:701
Mass (Da):76,633
Checksum:i12D26888C1F131B6
GO
Isoform 3 (identifier: P78563-3) [UniParc]FASTAAdd to basket
Also known as: DRADA2C

The sequence of this isoform differs from the canonical sequence as follows:
     713-741: ARLFTAFIKAGLGAWVEKPTEQDQFSLTP → VH

Show »
Length:714
Mass (Da):77,795
Checksum:i10F6C71FFB641CFE
GO
Isoform 4 (identifier: P78563-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKIPRMKTPCQPDRNSLRQSRNPQKYFAM
     466-505: Missing.

Show »
Length:729
Mass (Da):80,007
Checksum:iBAB59C894273C4E8
GO
Isoform 5 (identifier: P78563-5) [UniParc]FASTAAdd to basket
Also known as: ADAR2R

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASSTTPPLHMGTFFSVMGRRYKRRRKKRSERKDRNSLRQSRNPQKYFAM

Note: Likely expressed from an alternative promoter. Contains a region highly similar to the so-called ssRNA-binding R-domain of ADARB2.1 Publication
Show »
Length:790
Mass (Da):86,692
Checksum:i5FE50BA398BA0CA0
GO
Isoform 6 (identifier: P78563-6) [UniParc]FASTAAdd to basket
Also known as: ADAR2d

The sequence of this isoform differs from the canonical sequence as follows:
     466-505: Missing.
     713-741: ARLFTAFIKAGLGAWVEKPTEQDQFSLTP → VH

Show »
Length:674
Mass (Da):73,665
Checksum:iE55004CC0C4A1EFB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSG8A0A0A0MSG8_HUMAN
Double-stranded RNA-specific editas...
ADARB1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8TCX7Q8TCX7_HUMAN
Double-stranded RNA-specific editas...
ADARB1 hCG_2008433
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ACN49027 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti30G → A in AAB58300 (PubMed:9330641).Curated1
Sequence conflicti30G → A in AAM83100 (PubMed:12459255).Curated1
Sequence conflicti30G → A in AAM97654 (PubMed:12459255).Curated1
Sequence conflicti30G → A in AAN10291 (PubMed:12459255).Curated1
Sequence conflicti423R → E in AAB58300 (PubMed:9330641).Curated1
Sequence conflicti423R → E in AAM83100 (PubMed:12459255).Curated1
Sequence conflicti423R → E in AAM97654 (PubMed:12459255).Curated1
Sequence conflicti423R → E in AAN10291 (PubMed:12459255).Curated1
Sequence conflicti475V → L in AAM83100 (PubMed:12459255).Curated1
Sequence conflicti475V → L in AAN10291 (PubMed:12459255).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_070931224V → A1 PublicationCorresponds to variant dbSNP:rs199697177Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0195971M → MKIPRMKTPCQPDRNSLRQS RNPQKYFAM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0414211M → MASSTTPPLHMGTFFSVMGR RYKRRRKKRSERKDRNSLRQ SRNPQKYFAM in isoform 5. 1 Publication1
Alternative sequenceiVSP_000865466 – 505Missing in isoform 2, isoform 4 and isoform 6. 6 PublicationsAdd BLAST40
Alternative sequenceiVSP_000866713 – 741ARLFT…FSLTP → VH in isoform 3 and isoform 6. 2 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U82120 mRNA Translation: AAB61686.1
U82121 mRNA Translation: AAB61687.1
X99227 mRNA Translation: CAA67611.1
X99383 mRNA Translation: CAA67762.1
U76420 mRNA Translation: AAC51240.1
U76421 mRNA Translation: AAC51241.1
U76422 mRNA Translation: AAC51242.1
AF001042 mRNA Translation: AAB58300.1
AF525422 mRNA Translation: AAM83100.1
AF533142 mRNA Translation: AAM97654.1
AY135659 mRNA Translation: AAN10291.1
AB194370 mRNA Translation: BAE16326.1
AB194371 mRNA Translation: BAE16327.1
AB194372 mRNA Translation: BAE16328.1
AB194373 mRNA Translation: BAE16329.1
AL163301 Genomic DNA Translation: CAB90493.1
AL133499 Genomic DNA No translation available.
AP001579 Genomic DNA No translation available.
BX322560 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09357.1
CH471079 Genomic DNA Translation: EAX09359.1
CH471079 Genomic DNA Translation: EAX09360.1
BC065545 mRNA Translation: AAH65545.1
FJ169506 mRNA Translation: ACN49027.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33589.1 [P78563-1]
CCDS33590.1 [P78563-2]
CCDS42970.1 [P78563-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001103.1, NM_001112.3 [P78563-2]
NP_001153702.1, NM_001160230.1 [P78563-6]
NP_001333616.1, NM_001346687.1
NP_001333617.1, NM_001346688.1 [P78563-6]
NP_056648.1, NM_015833.3 [P78563-1]
NP_056649.1, NM_015834.3 [P78563-3]
XP_016883736.1, XM_017028247.1 [P78563-1]
XP_016883737.1, XM_017028248.1 [P78563-1]
XP_016883738.1, XM_017028249.1 [P78563-1]
XP_016883739.1, XM_017028250.1 [P78563-1]
XP_016883740.1, XM_017028251.1 [P78563-1]
XP_016883743.1, XM_017028254.1 [P78563-3]
XP_016883744.1, XM_017028255.1 [P78563-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.474018

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000348831; ENSP00000015877; ENSG00000197381 [P78563-2]
ENST00000360697; ENSP00000353920; ENSG00000197381 [P78563-1]
ENST00000389863; ENSP00000374513; ENSG00000197381 [P78563-3]
ENST00000437626; ENSP00000414600; ENSG00000197381 [P78563-1]
ENST00000492414; ENSP00000436367; ENSG00000197381 [P78563-2]
ENST00000496664; ENSP00000435381; ENSG00000197381 [P78563-1]
ENST00000629643; ENSP00000486475; ENSG00000197381 [P78563-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
104

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:104

UCSC genome browser

More...
UCSCi
uc002zgr.3 human [P78563-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U82120 mRNA Translation: AAB61686.1
U82121 mRNA Translation: AAB61687.1
X99227 mRNA Translation: CAA67611.1
X99383 mRNA Translation: CAA67762.1
U76420 mRNA Translation: AAC51240.1
U76421 mRNA Translation: AAC51241.1
U76422 mRNA Translation: AAC51242.1
AF001042 mRNA Translation: AAB58300.1
AF525422 mRNA Translation: AAM83100.1
AF533142 mRNA Translation: AAM97654.1
AY135659 mRNA Translation: AAN10291.1
AB194370 mRNA Translation: BAE16326.1
AB194371 mRNA Translation: BAE16327.1
AB194372 mRNA Translation: BAE16328.1
AB194373 mRNA Translation: BAE16329.1
AL163301 Genomic DNA Translation: CAB90493.1
AL133499 Genomic DNA No translation available.
AP001579 Genomic DNA No translation available.
BX322560 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09357.1
CH471079 Genomic DNA Translation: EAX09359.1
CH471079 Genomic DNA Translation: EAX09360.1
BC065545 mRNA Translation: AAH65545.1
FJ169506 mRNA Translation: ACN49027.1 Different initiation.
CCDSiCCDS33589.1 [P78563-1]
CCDS33590.1 [P78563-2]
CCDS42970.1 [P78563-3]
RefSeqiNP_001103.1, NM_001112.3 [P78563-2]
NP_001153702.1, NM_001160230.1 [P78563-6]
NP_001333616.1, NM_001346687.1
NP_001333617.1, NM_001346688.1 [P78563-6]
NP_056648.1, NM_015833.3 [P78563-1]
NP_056649.1, NM_015834.3 [P78563-3]
XP_016883736.1, XM_017028247.1 [P78563-1]
XP_016883737.1, XM_017028248.1 [P78563-1]
XP_016883738.1, XM_017028249.1 [P78563-1]
XP_016883739.1, XM_017028250.1 [P78563-1]
XP_016883740.1, XM_017028251.1 [P78563-1]
XP_016883743.1, XM_017028254.1 [P78563-3]
XP_016883744.1, XM_017028255.1 [P78563-2]
UniGeneiHs.474018

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZY7X-ray1.70A/B299-741[»]
5ED1X-ray2.77A/D299-741[»]
5ED2X-ray2.95A/D299-741[»]
5HP2X-ray2.98A/D299-741[»]
5HP3X-ray3.09A/D299-741[»]
ProteinModelPortaliP78563
SMRiP78563
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106618, 66 interactors
IntActiP78563, 22 interactors
MINTiP78563
STRINGi9606.ENSP00000353920

PTM databases

iPTMnetiP78563
PhosphoSitePlusiP78563

Polymorphism and mutation databases

BioMutaiADARB1
DMDMi2829669

Proteomic databases

EPDiP78563
jPOSTiP78563
MaxQBiP78563
PaxDbiP78563
PeptideAtlasiP78563
PRIDEiP78563
ProteomicsDBi57656
57657 [P78563-2]
57658 [P78563-3]
57659 [P78563-4]
57660 [P78563-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000348831; ENSP00000015877; ENSG00000197381 [P78563-2]
ENST00000360697; ENSP00000353920; ENSG00000197381 [P78563-1]
ENST00000389863; ENSP00000374513; ENSG00000197381 [P78563-3]
ENST00000437626; ENSP00000414600; ENSG00000197381 [P78563-1]
ENST00000492414; ENSP00000436367; ENSG00000197381 [P78563-2]
ENST00000496664; ENSP00000435381; ENSG00000197381 [P78563-1]
ENST00000629643; ENSP00000486475; ENSG00000197381 [P78563-4]
GeneIDi104
KEGGihsa:104
UCSCiuc002zgr.3 human [P78563-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
104
DisGeNETi104
EuPathDBiHostDB:ENSG00000197381.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADARB1
HGNCiHGNC:226 ADARB1
HPAiHPA029645
MIMi601218 gene
neXtProtiNX_P78563
OpenTargetsiENSG00000197381
PharmGKBiPA24556

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2777 Eukaryota
ENOG410XT0Z LUCA
GeneTreeiENSGT00940000155992
HOGENOMiHOG000213660
HOVERGENiHBG003836
InParanoidiP78563
KOiK13194
OMAiDNVQFHL
PhylomeDBiP78563
TreeFamiTF315806

Enzyme and pathway databases

BRENDAi3.5.4.37 2681
ReactomeiR-HSA-75102 C6 deamination of adenosine
R-HSA-77042 Formation of editosomes by ADAR proteins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ADARB1 human
EvolutionaryTraceiP78563

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ADARB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
104

Protein Ontology

More...
PROi
PR:P78563

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000197381 Expressed in 224 organ(s), highest expression level in esophagus
ExpressionAtlasiP78563 baseline and differential
GenevisibleiP78563 HS

Family and domain databases

CDDicd00048 DSRM, 2 hits
InterProiView protein in InterPro
IPR002466 A_deamin
IPR014720 dsRBD_dom
IPR008996 IL1/FGF
PfamiView protein in Pfam
PF02137 A_deamin, 1 hit
PF00035 dsrm, 2 hits
SMARTiView protein in SMART
SM00552 ADEAMc, 1 hit
SM00358 DSRM, 2 hits
SUPFAMiSSF50353 SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS50141 A_DEAMIN_EDITASE, 1 hit
PS50137 DS_RBD, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRED1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78563
Secondary accession number(s): A6NFK8
, A6NJ84, C3TTQ1, C3TTQ2, C9JUP4, G5E9B4, O00395, O00465, O00691, O00692, P78555, Q4AE77, Q4AE79, Q6P0M9, Q8NFA1, Q8NFD1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: January 16, 2019
This is version 179 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again