Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (16 Oct 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Sushi repeat-containing protein SRPX

Gene

SRPX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P78539

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sushi repeat-containing protein SRPX
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SRPX
Synonyms:ETX1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11309 SRPX

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300187 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78539

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8406

Open Targets

More...
OpenTargetsi
ENSG00000101955

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA36133

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P78539

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SRPX

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2498958

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 30Sequence analysisAdd BLAST30
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002241631 – 464Sushi repeat-containing protein SRPXAdd BLAST434

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi57 ↔ 85PROSITE-ProRule annotation
Disulfide bondi69 ↔ 103PROSITE-ProRule annotation
Disulfide bondi89 ↔ 115PROSITE-ProRule annotation
Disulfide bondi120 ↔ 161PROSITE-ProRule annotation
Disulfide bondi147 ↔ 174PROSITE-ProRule annotation
Disulfide bondi262 ↔ 304PROSITE-ProRule annotation
Disulfide bondi290 ↔ 317PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78539

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P78539

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78539

PeptideAtlas

More...
PeptideAtlasi
P78539

PRoteomics IDEntifications database

More...
PRIDEi
P78539

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
26540
32366
57641 [P78539-1]
57642 [P78539-2]
57643 [P78539-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P78539

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78539

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Retina and heart; less in placenta, pancreas, lung, liver, skeletal muscle, kidney and brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101955 Expressed in 227 organ(s), highest expression level in smooth muscle tissue

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78539 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q9BRX26EBI-2371213,EBI-1043580

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113994, 3 interactors

Protein interaction database and analysis system

More...
IntActi
P78539, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000367794

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini57 – 117Sushi 1PROSITE-ProRule annotationAdd BLAST61
Domaini118 – 176Sushi 2PROSITE-ProRule annotationAdd BLAST59
Domaini177 – 259HYRPROSITE-ProRule annotationAdd BLAST83
Domaini260 – 319Sushi 3PROSITE-ProRule annotationAdd BLAST60

Keywords - Domaini

Repeat, Signal, Sushi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEWW Eukaryota
ENOG410XP80 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160302

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232093

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78539

Identification of Orthologs from Complete Genome Data

More...
OMAi
PARVCQY

Database of Orthologous Groups

More...
OrthoDBi
544541at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78539

TreeFam database of animal gene trees

More...
TreeFami
TF336515

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00033 CCP, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025232 DUF4174
IPR003410 HYR_dom
IPR036981 SRPX
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR46343:SF1 PTHR46343:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13778 DUF4174, 1 hit
PF02494 HYR, 1 hit
PF00084 Sushi, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00032 CCP, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57535 SSF57535, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50825 HYR, 1 hit
PS50923 SUSHI, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P78539-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSPAHRPAL LLLLPPLLLL LLLRVPPSRS FPGSGDSPLE DDEVGYSHPR
60 70 80 90 100
YKDTPWCSPI KVKYGDVYCR APQGGYYKTA LGTRCDIRCQ KGYELHGSSL
110 120 130 140 150
LICQSNKRWS DKVICKQKRC PTLAMPANGG FKCVDGAYFN SRCEYYCSPG
160 170 180 190 200
YTLKGERTVT CMDNKAWSGR PASCVDMEPP RIKCPSVKER IAEPNKLTVR
210 220 230 240 250
VSWETPEGRD TADGILTDVI LKGLPPGSNF PEGDHKIQYT VYDRAENKGT
260 270 280 290 300
CKFRVKVRVK RCGKLNAPEN GYMKCSSDGD NYGATCEFSC IGGYELQGSP
310 320 330 340 350
ARVCQSNLAW SGTEPTCAAM NVNVGVRTAA ALLDQFYEKR RLLIVSTPTA
360 370 380 390 400
RNLLYRLQLG MLQQAQCGLD LRHITVVELV GVFPTLIGRI GAKIMPPALA
410 420 430 440 450
LQLRLLLRIP LYSFSMVLVD KHGMDKERYV SLVMPVALFN LIDTFPLRKE
460
EMVLQAEMSQ TCNT
Length:464
Mass (Da):51,572
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9CD5E57BC2848680
GO
Isoform 2 (identifier: P78539-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MGSPAHRPAL...EVGYSHPRYK → MDFDVGRTTH...RRCLIGESGH

Show »
Length:451
Mass (Da):49,934
Checksum:iAAE97A096B950609
GO
Isoform 3 (identifier: P78539-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-176: QKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVD → H

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):45,121
Checksum:iC8C21CD2E06B7BA8
GO
Isoform 4 (identifier: P78539-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-464: QAQCGLDLRH...QAEMSQTCNT → AVAANPTLLLQYGASG

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):41,750
Checksum:i27FFD6B0F84D18A2
GO
Isoform 5 (identifier: P78539-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-52: Missing.

Show »
Length:444
Mass (Da):49,382
Checksum:i369E18F51CECE377
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti170 – 178RPASCVDME → ASLLCGYG in AAB40715 (PubMed:9162095).Curated9
Sequence conflicti202Missing in AAB40715 (PubMed:9162095).Curated1
Sequence conflicti242Y → H in BAG54210 (PubMed:14702039).Curated1
Sequence conflicti292G → S in BAF82119 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_00562423Missing 3 Publications1
Natural variantiVAR_005625225P → S1 PublicationCorresponds to variant dbSNP:rs1123773Ensembl.1
Natural variantiVAR_005626413S → F1 PublicationCorresponds to variant dbSNP:rs35318931Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0044301 – 52MGSPA…HPRYK → MDFDVGRTTHLSSSPCSASN GGESGQVSKRRCLIGESGH in isoform 2. CuratedAdd BLAST52
Alternative sequenceiVSP_04675733 – 52Missing in isoform 5. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_043056117 – 176QKRCP…ASCVD → H in isoform 3. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_045468364 – 464QAQCG…QTCNT → AVAANPTLLLQYGASG in isoform 4. 1 PublicationAdd BLAST101

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U78093 mRNA Translation: AAB36685.1
S82496 Genomic DNA Translation: AAB37378.1
S82496 Genomic DNA Translation: AAB37379.1
AK125542 mRNA Translation: BAG54210.1
U61374 mRNA Translation: AAB40715.1
AK289430 mRNA Translation: BAF82119.1
AK293127 mRNA Translation: BAG56679.1
AK298802 mRNA Translation: BAG60937.1
AL121578 Genomic DNA No translation available.
AL133494 Genomic DNA No translation available.
AL606748 Genomic DNA No translation available.
AL627246 Genomic DNA No translation available.
CH471141 Genomic DNA Translation: EAW59447.1
BC020684 mRNA Translation: AAH20684.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14245.1 [P78539-1]
CCDS55400.1 [P78539-5]
CCDS55401.1 [P78539-3]
CCDS55402.1 [P78539-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001164221.1, NM_001170750.1 [P78539-5]
NP_001164222.1, NM_001170751.1 [P78539-3]
NP_001164223.1, NM_001170752.1 [P78539-4]
NP_006298.1, NM_006307.4 [P78539-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000378533; ENSP00000367794; ENSG00000101955 [P78539-1]
ENST00000432886; ENSP00000411165; ENSG00000101955 [P78539-3]
ENST00000538295; ENSP00000445034; ENSG00000101955 [P78539-4]
ENST00000544439; ENSP00000440758; ENSG00000101955 [P78539-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8406

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8406

UCSC genome browser

More...
UCSCi
uc004ddy.3 human [P78539-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U78093 mRNA Translation: AAB36685.1
S82496 Genomic DNA Translation: AAB37378.1
S82496 Genomic DNA Translation: AAB37379.1
AK125542 mRNA Translation: BAG54210.1
U61374 mRNA Translation: AAB40715.1
AK289430 mRNA Translation: BAF82119.1
AK293127 mRNA Translation: BAG56679.1
AK298802 mRNA Translation: BAG60937.1
AL121578 Genomic DNA No translation available.
AL133494 Genomic DNA No translation available.
AL606748 Genomic DNA No translation available.
AL627246 Genomic DNA No translation available.
CH471141 Genomic DNA Translation: EAW59447.1
BC020684 mRNA Translation: AAH20684.1
CCDSiCCDS14245.1 [P78539-1]
CCDS55400.1 [P78539-5]
CCDS55401.1 [P78539-3]
CCDS55402.1 [P78539-4]
RefSeqiNP_001164221.1, NM_001170750.1 [P78539-5]
NP_001164222.1, NM_001170751.1 [P78539-3]
NP_001164223.1, NM_001170752.1 [P78539-4]
NP_006298.1, NM_006307.4 [P78539-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi113994, 3 interactors
IntActiP78539, 5 interactors
STRINGi9606.ENSP00000367794

PTM databases

iPTMnetiP78539
PhosphoSitePlusiP78539

Polymorphism and mutation databases

BioMutaiSRPX
DMDMi2498958

Proteomic databases

jPOSTiP78539
MassIVEiP78539
PaxDbiP78539
PeptideAtlasiP78539
PRIDEiP78539
ProteomicsDBi26540
32366
57641 [P78539-1]
57642 [P78539-2]
57643 [P78539-3]

Genome annotation databases

EnsembliENST00000378533; ENSP00000367794; ENSG00000101955 [P78539-1]
ENST00000432886; ENSP00000411165; ENSG00000101955 [P78539-3]
ENST00000538295; ENSP00000445034; ENSG00000101955 [P78539-4]
ENST00000544439; ENSP00000440758; ENSG00000101955 [P78539-5]
GeneIDi8406
KEGGihsa:8406
UCSCiuc004ddy.3 human [P78539-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8406
DisGeNETi8406

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SRPX
HGNCiHGNC:11309 SRPX
MIMi300187 gene
neXtProtiNX_P78539
OpenTargetsiENSG00000101955
PharmGKBiPA36133

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEWW Eukaryota
ENOG410XP80 LUCA
GeneTreeiENSGT00940000160302
HOGENOMiHOG000232093
InParanoidiP78539
OMAiPARVCQY
OrthoDBi544541at2759
PhylomeDBiP78539
TreeFamiTF336515

Enzyme and pathway databases

SIGNORiP78539

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SRPX human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SRPX

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8406
PharosiP78539

Protein Ontology

More...
PROi
PR:P78539

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101955 Expressed in 227 organ(s), highest expression level in smooth muscle tissue
GenevisibleiP78539 HS

Family and domain databases

CDDicd00033 CCP, 3 hits
InterProiView protein in InterPro
IPR025232 DUF4174
IPR003410 HYR_dom
IPR036981 SRPX
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PANTHERiPTHR46343:SF1 PTHR46343:SF1, 1 hit
PfamiView protein in Pfam
PF13778 DUF4174, 1 hit
PF02494 HYR, 1 hit
PF00084 Sushi, 3 hits
SMARTiView protein in SMART
SM00032 CCP, 3 hits
SUPFAMiSSF57535 SSF57535, 3 hits
PROSITEiView protein in PROSITE
PS50825 HYR, 1 hit
PS50923 SUSHI, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSRPX_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78539
Secondary accession number(s): A8K065
, B3KWP8, B4DDB8, B4DQH5, F5H4D7, G3V1L0, Q4VX66, Q99652, Q99913
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: October 16, 2019
This is version 166 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again