Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 163 (13 Feb 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

CMP-sialic acid transporter

Gene

SLC35A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processSugar transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-4085001 Sialic acid metabolism
R-HSA-5619037 Defective SLC35A1 causes congenital disorder of glycosylation 2F (CDG2F)
R-HSA-5663020 Defective SLC35A1 causes congenital disorder of glycosylation 2F (CDG2F)
R-HSA-727802 Transport of nucleotide sugars

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.7.12.11 the drug/metabolite transporter (dmt) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CMP-sialic acid transporter
Short name:
CMP-SA-Tr
Short name:
CMP-Sia-Tr
Alternative name(s):
Solute carrier family 35 member A1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC35A1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164414.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11021 SLC35A1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605634 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78382

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 9CytoplasmicSequence analysis9
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Topological domaini31 – 45LumenalSequence analysisAdd BLAST15
Transmembranei46 – 64HelicalSequence analysisAdd BLAST19
Topological domaini65 – 87CytoplasmicSequence analysisAdd BLAST23
Transmembranei88 – 108HelicalSequence analysisAdd BLAST21
Topological domaini109 – 113LumenalSequence analysis5
Transmembranei114 – 135HelicalSequence analysisAdd BLAST22
Topological domaini136 – 141CytoplasmicSequence analysis6
Transmembranei142 – 160HelicalSequence analysisAdd BLAST19
Topological domaini161 – 175LumenalSequence analysisAdd BLAST15
Transmembranei176 – 196HelicalSequence analysisAdd BLAST21
Topological domaini197 – 212CytoplasmicSequence analysisAdd BLAST16
Transmembranei213 – 228HelicalSequence analysisAdd BLAST16
Topological domaini229 – 243LumenalSequence analysisAdd BLAST15
Transmembranei244 – 262HelicalSequence analysisAdd BLAST19
Topological domaini263 – 272CytoplasmicSequence analysis10
Transmembranei273 – 291HelicalSequence analysisAdd BLAST19
Topological domaini292 – 296LumenalSequence analysis5
Transmembranei297 – 315HelicalSequence analysisAdd BLAST19
Topological domaini316 – 337CytoplasmicSequence analysisAdd BLAST22

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Congenital disorder of glycosylation 2F (CDG2F)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionCDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
See also OMIM:603585

Keywords - Diseasei

Congenital disorder of glycosylation

Organism-specific databases

DisGeNET

More...
DisGeNETi
10559

MalaCards human disease database

More...
MalaCardsi
SLC35A1
MIMi603585 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000164414

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
238459 SLC35A1-CDG

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35889

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC35A1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2499226

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002133511 – 337CMP-sialic acid transporterAdd BLAST337

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P78382

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78382

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P78382

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78382

PeptideAtlas

More...
PeptideAtlasi
P78382

PRoteomics IDEntifications database

More...
PRIDEi
P78382

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57606
57607 [P78382-2]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78382

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164414 Expressed in 94 organ(s), highest expression level in caudate nucleus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P78382 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78382 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115810, 18 interactors

Protein interaction database and analysis system

More...
IntActi
P78382, 27 interactors

Molecular INTeraction database

More...
MINTi
P78382

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000358565

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P78382

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2234 Eukaryota
COG0697 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156727

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000216649

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054025

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78382

KEGG Orthology (KO)

More...
KOi
K15272

Identification of Orthologs from Complete Genome Data

More...
OMAi
QNNMAFV

Database of Orthologous Groups

More...
OrthoDBi
703674at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78382

TreeFam database of animal gene trees

More...
TreeFami
TF315345

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007271 Nuc_sug_transpt

The PANTHER Classification System

More...
PANTHERi
PTHR10231 PTHR10231, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04142 Nuc_sug_transp, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005799 UDP-gal_transpt, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78382-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAPRDNVTL LFKLYCLAVM TLMAAVYTIA LRYTRTSDKE LYFSTTAVCI
60 70 80 90 100
TEVIKLLLSV GILAKETGSL GRFKASLREN VLGSPKELLK LSVPSLVYAV
110 120 130 140 150
QNNMAFLALS NLDAAVYQVT YQLKIPCTAL CTVLMLNRTL SKLQWVSVFM
160 170 180 190 200
LCAGVTLVQW KPAQATKVVV EQNPLLGFGA IAIAVLCSGF AGVYFEKVLK
210 220 230 240 250
SSDTSLWVRN IQMYLSGIIV TLAGVYLSDG AEIKEKGFFY GYTYYVWFVI
260 270 280 290 300
FLASVGGLYT SVVVKYTDNI MKGFSAAAAI VLSTIASVML FGLQITLTFA
310 320 330
LGTLLVCVSI YLYGLPRQDT TSIQQGETAS KERVIGV
Length:337
Mass (Da):36,779
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i508DD77F5EEBB5A7
GO
Isoform 2 (identifier: P78382-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-251: GVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIF → V

Note: No experimental confirmation available.
Show »
Length:278
Mass (Da):29,919
Checksum:iCA0BD6699B9F97B0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5W1L7Q5W1L7_HUMAN
CMP-sialic acid transporter
SLC35A1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WVM1A0A087WVM1_HUMAN
CMP-sialic acid transporter
SLC35A1
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042916192 – 251GVYFE…WFVIF → V in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D87969 mRNA Translation: BAA13522.1
AJ851888 mRNA Translation: CAH65468.1
AL049697 Genomic DNA No translation available.
BC017807 mRNA Translation: AAH17807.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5010.1 [P78382-1]
CCDS55043.1 [P78382-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC5023

NCBI Reference Sequences

More...
RefSeqi
NP_001161870.1, NM_001168398.1 [P78382-2]
NP_006407.1, NM_006416.4 [P78382-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.423163

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000369552; ENSP00000358565; ENSG00000164414 [P78382-1]
ENST00000369556; ENSP00000358569; ENSG00000164414 [P78382-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10559

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10559

UCSC genome browser

More...
UCSCi
uc010kbx.4 human [P78382-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87969 mRNA Translation: BAA13522.1
AJ851888 mRNA Translation: CAH65468.1
AL049697 Genomic DNA No translation available.
BC017807 mRNA Translation: AAH17807.1
CCDSiCCDS5010.1 [P78382-1]
CCDS55043.1 [P78382-2]
PIRiJC5023
RefSeqiNP_001161870.1, NM_001168398.1 [P78382-2]
NP_006407.1, NM_006416.4 [P78382-1]
UniGeneiHs.423163

3D structure databases

ProteinModelPortaliP78382
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115810, 18 interactors
IntActiP78382, 27 interactors
MINTiP78382
STRINGi9606.ENSP00000358565

Protein family/group databases

TCDBi2.A.7.12.11 the drug/metabolite transporter (dmt) superfamily

PTM databases

PhosphoSitePlusiP78382

Polymorphism and mutation databases

BioMutaiSLC35A1
DMDMi2499226

Proteomic databases

EPDiP78382
jPOSTiP78382
MaxQBiP78382
PaxDbiP78382
PeptideAtlasiP78382
PRIDEiP78382
ProteomicsDBi57606
57607 [P78382-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10559
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369552; ENSP00000358565; ENSG00000164414 [P78382-1]
ENST00000369556; ENSP00000358569; ENSG00000164414 [P78382-2]
GeneIDi10559
KEGGihsa:10559
UCSCiuc010kbx.4 human [P78382-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10559
DisGeNETi10559
EuPathDBiHostDB:ENSG00000164414.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC35A1
HGNCiHGNC:11021 SLC35A1
MalaCardsiSLC35A1
MIMi603585 phenotype
605634 gene
neXtProtiNX_P78382
OpenTargetsiENSG00000164414
Orphaneti238459 SLC35A1-CDG
PharmGKBiPA35889

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2234 Eukaryota
COG0697 LUCA
GeneTreeiENSGT00940000156727
HOGENOMiHOG000216649
HOVERGENiHBG054025
InParanoidiP78382
KOiK15272
OMAiQNNMAFV
OrthoDBi703674at2759
PhylomeDBiP78382
TreeFamiTF315345

Enzyme and pathway databases

ReactomeiR-HSA-4085001 Sialic acid metabolism
R-HSA-5619037 Defective SLC35A1 causes congenital disorder of glycosylation 2F (CDG2F)
R-HSA-5663020 Defective SLC35A1 causes congenital disorder of glycosylation 2F (CDG2F)
R-HSA-727802 Transport of nucleotide sugars

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC35A1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10559

Protein Ontology

More...
PROi
PR:P78382

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164414 Expressed in 94 organ(s), highest expression level in caudate nucleus
ExpressionAtlasiP78382 baseline and differential
GenevisibleiP78382 HS

Family and domain databases

InterProiView protein in InterPro
IPR007271 Nuc_sug_transpt
PANTHERiPTHR10231 PTHR10231, 1 hit
PfamiView protein in Pfam
PF04142 Nuc_sug_transp, 1 hit
PIRSFiPIRSF005799 UDP-gal_transpt, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS35A1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78382
Secondary accession number(s): Q5W1L8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: February 13, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again