Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cancer/testis antigen 1

Gene

CTAG1A

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Cancer/testis antigen 1
Alternative name(s):
Autoimmunogenic cancer/testis antigen NY-ESO-1
Cancer/testis antigen 6.1
Short name:
CT6.1
L antigen family member 2
Short name:
LAGE-2
Gene namesi
Name:CTAG1A
Synonyms:CTAG, CTAG1, ESO1, LAGE2, LAGE2A
AND
Name:CTAG1B
Synonyms:LAGE2B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000184033.12
HostDB:ENSG00000268651.2
HGNCiHGNC:24198 CTAG1A
HGNC:2491 CTAG1B
MIMi300156 gene
300657 gene
neXtProtiNX_P78358

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi1485
246100
OpenTargetsiENSG00000184033
PharmGKBiPA134979749

Polymorphism and mutation databases

DMDMi6014739

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002189221 – 180Cancer/testis antigen 1Add BLAST180

Proteomic databases

PaxDbiP78358
PeptideAtlasiP78358
PRIDEiP78358
ProteomicsDBi57589
57590 [P78358-2]
TopDownProteomicsiP78358-1 [P78358-1]

PTM databases

iPTMnetiP78358
PhosphoSitePlusiP78358

Expressioni

Tissue specificityi

Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000184033
CleanExiHS_CTAG1A
HS_CTAG1B
ExpressionAtlasiP78358 baseline
GenevisibleiP78358 HS

Organism-specific databases

HPAiCAB013061
CAB015453

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi107867, 2 interactors
128863, 7 interactors
IntActiP78358, 74 interactors
STRINGi9606.ENSP00000332602

Structurei

Secondary structure

1180
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi64 – 66Combined sources3
Turni67 – 69Combined sources3

3D structure databases

ProteinModelPortaliP78358
SMRiP78358
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78358

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 82Gly-richAdd BLAST78

Sequence similaritiesi

Belongs to the CTAG/PCC1 family.Curated

Phylogenomic databases

eggNOGiENOG410JHSY Eukaryota
ENOG411148V LUCA
GeneTreeiENSGT00900000141413
HOGENOMiHOG000040003
HOVERGENiHBG051214
InParanoidiP78358
OMAiWEKRPET
PhylomeDBiP78358
TreeFamiTF337064

Family and domain databases

InterProiView protein in InterPro
IPR015419 CTAG/Pcc1
PfamiView protein in Pfam
PF09341 Pcc1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78358-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAEGRGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA
60 70 80 90 100
ARASGPGGGA PRGPHGGAAS GLNGCCRCGA RGPESRLLEF YLAMPFATPM
110 120 130 140 150
EAELARRSLA QDAPPLPVPG VLLKEFTVSG NILTIRLTAA DHRQLQLSIS
160 170 180
SCLQQLSLLM WITQCFLPVF LAQPPSGQRR
Length:180
Mass (Da):17,992
Last modified:May 1, 1997 - v1
Checksum:iB122C5C2C8BE1569
GO
Isoform 2 (identifier: P78358-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC

Show »
Length:168
Mass (Da):16,192
Checksum:iC71F3242B5440169
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_028548135 – 180IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U87459 mRNA Translation: AAB49693.1
AJ003149 mRNA Translation: CAA05908.1
AF038567 mRNA Translation: AAD05202.1
AJ275977 Genomic DNA Translation: CAB76943.1
AF277315 Genomic DNA Translation: AAL27013.1
AF277315 Genomic DNA Translation: AAL27014.1
CH471172 Genomic DNA Translation: EAW72673.1
CH471172 Genomic DNA Translation: EAW72674.1
BC130362 mRNA Translation: AAI30363.1
BC130364 mRNA Translation: AAI30365.1
AJ275978 mRNA Translation: CAB76945.1
CCDSiCCDS14758.1 [P78358-1]
CCDS44025.1 [P78358-1]
RefSeqiNP_001318.1, NM_001327.2 [P78358-1]
NP_640343.1, NM_139250.1 [P78358-1]
UniGeneiHs.534310
Hs.745351

Genome annotation databases

EnsembliENST00000328435; ENSP00000332602; ENSG00000184033 [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033 [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651 [P78358-1]
GeneIDi1485
246100
KEGGihsa:1485
hsa:246100
UCSCiuc004fme.3 human [P78358-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCTG1B_HUMAN
AccessioniPrimary (citable) accession number: P78358
Secondary accession number(s): A1L417
, B7WNL9, Q7LBY4, Q9NY13
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: July 18, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health