Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P78358 (CTG1B_HUMAN)

Entry version 163 (16 Oct 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cancer/testis antigen 1

Gene

CTAG1A

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cancer/testis antigen 1
Alternative name(s):
Autoimmunogenic cancer/testis antigen NY-ESO-1
Cancer/testis antigen 6.1
Short name:
CT6.1
L antigen family member 2
Short name:
LAGE-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CTAG1A
Synonyms:CTAG, CTAG1, ESO1, LAGE2, LAGE2A
AND
Name:CTAG1B
Synonyms:LAGE2B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24198 CTAG1A
HGNC:2491 CTAG1B

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300156 gene
300657 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P78358

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		1485
246100

Open Targets

More...OpenTargetsi		ENSG00000184033

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134979749

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P78358

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CTAG1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		6014739

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002189221 – 180Cancer/testis antigen 1Add BLAST180

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P78358

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P78358

PeptideAtlas

More...PeptideAtlasi		P78358

PRoteomics IDEntifications database

More...PRIDEi		P78358

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		57589 [P78358-1]
57590 [P78358-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P78358-1 [P78358-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P78358

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P78358

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000184033 Expressed in 19 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P78358 baseline

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P78358 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB013061
CAB015453

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107867, 2 interactors
128863, 7 interactors

Protein interaction database and analysis system

More...IntActi		P78358, 74 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000469441

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1180
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P78358

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P78358

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi5 – 82Gly-richAdd BLAST78

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CTAG/PCC1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410JHSY Eukaryota
ENOG411148V LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00410000025802

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000040003

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P78358

Identification of Orthologs from Complete Genome Data

More...OMAi		FLFRISI

Database of Orthologous Groups

More...OrthoDBi		1584653at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P78358

TreeFam database of animal gene trees

More...TreeFami		TF337064

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR015419 CTAG/Pcc1

The PANTHER Classification System

More...PANTHERi		PTHR31283 PTHR31283, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09341 Pcc1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P78358-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAEGRGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA 
        60         70         80         90        100
ARASGPGGGA PRGPHGGAAS GLNGCCRCGA RGPESRLLEF YLAMPFATPM 
       110        120        130        140        150
EAELARRSLA QDAPPLPVPG VLLKEFTVSG NILTIRLTAA DHRQLQLSIS 
       160        170        180
SCLQQLSLLM WITQCFLPVF LAQPPSGQRR
Length:180
Mass (Da):17,992
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB122C5C2C8BE1569
GO
Isoform 2 (identifier: P78358-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC

Show »
Length:168
Mass (Da):16,192
Checksum:iC71F3242B5440169
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTT5A0A0A0MTT5_HUMAN
Cancer/testis antigen 1
CTAG1A
210Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028548135 – 180IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U87459 mRNA Translation: AAB49693.1
AJ003149 mRNA Translation: CAA05908.1
AF038567 mRNA Translation: AAD05202.1
AJ275977 Genomic DNA Translation: CAB76943.1
AF277315 Genomic DNA Translation: AAL27013.1
AF277315 Genomic DNA Translation: AAL27014.1
CH471172 Genomic DNA Translation: EAW72673.1
CH471172 Genomic DNA Translation: EAW72674.1
BC130362 mRNA Translation: AAI30363.1
BC130364 mRNA Translation: AAI30365.1
AJ275978 mRNA Translation: CAB76945.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14758.1 [P78358-1]
CCDS44025.1 [P78358-1]

NCBI Reference Sequences

More...RefSeqi		NP_001318.1, NM_001327.2 [P78358-1]
NP_640343.1, NM_139250.1 [P78358-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000328435; ENSP00000332602; ENSG00000184033 [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033 [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651 [P78358-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1485
246100

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1485
hsa:246100

UCSC genome browser

More...UCSCi		uc004fme.3 human [P78358-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U87459 mRNA Translation: AAB49693.1
AJ003149 mRNA Translation: CAA05908.1
AF038567 mRNA Translation: AAD05202.1
AJ275977 Genomic DNA Translation: CAB76943.1
AF277315 Genomic DNA Translation: AAL27013.1
AF277315 Genomic DNA Translation: AAL27014.1
CH471172 Genomic DNA Translation: EAW72673.1
CH471172 Genomic DNA Translation: EAW72674.1
BC130362 mRNA Translation: AAI30363.1
BC130364 mRNA Translation: AAI30365.1
AJ275978 mRNA Translation: CAB76945.1
CCDSiCCDS14758.1 [P78358-1]
CCDS44025.1 [P78358-1]
RefSeqiNP_001318.1, NM_001327.2 [P78358-1]
NP_640343.1, NM_139250.1 [P78358-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1S9WX-ray2.20C157-165[»]
2BNQX-ray1.70C157-164[»]
2BNRX-ray1.90C157-165[»]
2F53X-ray2.10C157-165[»]
2F54X-ray2.70C/H157-165[»]
2P5EX-ray1.89C157-165[»]
2P5WX-ray2.20C157-165[»]
2PYEX-ray2.30C157-165[»]
3GJFX-ray1.90C/F157-164[»]
3HAEX-ray2.90C/F/M/R157-164[»]
3KLAX-ray1.65C/F157-165[»]
6AT5X-ray1.50C60-72[»]
6AVFX-ray2.03P60-72[»]
6AVGX-ray2.60P/Q60-72[»]
SMRiP78358
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi107867, 2 interactors
128863, 7 interactors
IntActiP78358, 74 interactors
STRINGi9606.ENSP00000469441

PTM databases

iPTMnetiP78358
PhosphoSitePlusiP78358

Polymorphism and mutation databases

BioMutaiCTAG1A
DMDMi6014739

Proteomic databases

MassIVEiP78358
PaxDbiP78358
PeptideAtlasiP78358
PRIDEiP78358
ProteomicsDBi57589 [P78358-1]
57590 [P78358-2]
TopDownProteomicsiP78358-1 [P78358-1]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P78358

The DNASU plasmid repository

More...DNASUi		246100

Genome annotation databases

EnsembliENST00000328435; ENSP00000332602; ENSG00000184033 [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033 [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651 [P78358-1]
GeneIDi1485
246100
KEGGihsa:1485
hsa:246100
UCSCiuc004fme.3 human [P78358-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1485
246100
DisGeNETi1485
246100

GeneCards: human genes, protein and diseases

More...GeneCardsi		CTAG1A
CTAG1B
HGNCiHGNC:24198 CTAG1A
HGNC:2491 CTAG1B
HPAiCAB013061
CAB015453
MIMi300156 gene
300657 gene
neXtProtiNX_P78358
OpenTargetsiENSG00000184033
PharmGKBiPA134979749

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410JHSY Eukaryota
ENOG411148V LUCA
GeneTreeiENSGT00410000025802
HOGENOMiHOG000040003
InParanoidiP78358
OMAiFLFRISI
OrthoDBi1584653at2759
PhylomeDBiP78358
TreeFamiTF337064

Miscellaneous databases

EvolutionaryTraceiP78358

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CTAG1B
PharosiP78358

Protein Ontology

More...PROi		PR:P78358

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000184033 Expressed in 19 organ(s), highest expression level in right testis
ExpressionAtlasiP78358 baseline
GenevisibleiP78358 HS

Family and domain databases

InterProiView protein in InterPro
IPR015419 CTAG/Pcc1
PANTHERiPTHR31283 PTHR31283, 1 hit
PfamiView protein in Pfam
PF09341 Pcc1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCTG1B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78358
Secondary accession number(s): A1L417
, B7WNL9, Q7LBY4, Q9NY13
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: October 16, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again