Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 4

Gene

DLG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Also regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression.By similarity

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-399719 Trafficking of AMPA receptors
R-HSA-438066 Unblocking of NMDA receptor, glutamate binding and activation
R-HSA-442729 CREB phosphorylation through the activation of CaMKII
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-5625900 RHO GTPases activate CIT
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-8849932 Synaptic adhesion-like molecules
SignaLinkiP78352
SIGNORiP78352

Protein family/group databases

MoonDBiP78352 Predicted
TCDBi8.A.24.1.3 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 4
Alternative name(s):
Postsynaptic density protein 95
Short name:
PSD-95
Synapse-associated protein 90
Short name:
SAP-90
Short name:
SAP90
Gene namesi
Name:DLG4
Synonyms:PSD95
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000132535.18
HGNCiHGNC:2903 DLG4
MIMi602887 gene
neXtProtiNX_P78352

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi1742
OpenTargetsiENSG00000132535
PharmGKBiPA27359

Chemistry databases

ChEMBLiCHEMBL5666
DrugBankiDB00536 Guanidine
DB01972 Guanosine-5'-Monophosphate

Polymorphism and mutation databases

BioMutaiDLG4
DMDMi71658825

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945601 – 724Disks large homolog 4Add BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi3S-palmitoyl cysteineBy similarity1
Lipidationi5S-palmitoyl cysteineBy similarity1
Modified residuei73PhosphoserineBy similarity1
Modified residuei142PhosphoserineBy similarity1
Modified residuei240PhosphotyrosineBy similarity1
Modified residuei295PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei418PhosphoserineBy similarity1
Modified residuei420PhosphothreonineBy similarity1
Modified residuei422PhosphoserineBy similarity1
Modified residuei425PhosphoserineBy similarity1
Modified residuei449PhosphoserineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei580PhosphotyrosineBy similarity1
Modified residuei606PhosphoserineBy similarity1
Modified residuei654PhosphoserineBy similarity1
Modified residuei715PhosphotyrosineBy similarity1

Post-translational modificationi

Palmitoylated (PubMed:26701913). Palmitoylation is required for targeting to postsynaptic density, plasma membrane and synapses (By similarity). Palmitoylation may play a role in glutamate receptor GRIA1 synapse clustering (By similarity). Depalmitoylated by ABHD17A and ABHD17B and to a lesser extent by ABHD17C, ABHD12, ABHD13, LYPLA1 and LYPLA2 (PubMed:26701913). Undergoes rapid synaptic palmitoylation/depalmitoylation cycles during neuronal development which slow down in mature neurons (By similarity).By similarity1 Publication
Ubiquitinated by MDM2 in response to NMDA receptor activation, leading to proteasome-mediated degradation of DLG4 which is required for AMPA receptor endocytosis.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP78352
MaxQBiP78352
PaxDbiP78352
PeptideAtlasiP78352
PRIDEiP78352
ProteomicsDBi57584
57585 [P78352-2]

PTM databases

iPTMnetiP78352
PhosphoSitePlusiP78352
SwissPalmiP78352

Expressioni

Tissue specificityi

Brain.

Gene expression databases

BgeeiENSG00000132535 Expressed in 146 organ(s), highest expression level in dorsolateral prefrontal cortex
CleanExiHS_DLG4
ExpressionAtlasiP78352 baseline and differential
GenevisibleiP78352 HS

Organism-specific databases

HPAiCAB001999
CAB002000
HPA010122

Interactioni

Subunit structurei

Interacts through its PDZ domains with ANO2 and NETO1 (By similarity). Interacts through its first two PDZ domains with GRIN2A, GRIN2B, GRIN2C, GRIN2D (By similarity). Interacts with ASIC3 (By similarity). Interacts with SEMA4C (By similarity). Interacts with CXADR (By similarity). Interacts with KCND2 (By similarity). Interacts with SYNGAP1 (By similarity). Interacts with LRRC4 and LRRC4B (By similarity). Interacts with ERBB4 (PubMed:10725395). Interacts with KCNA1, KCNA2, KCNA3 and KCNA4 (PubMed:7477295). Interacts through its first PDZ domain with GRIK2, KCNA4 and CRIPT (PubMed:11744724). Interacts through its second PDZ domain with the PDZ domain of NOS1 or the C-terminus of CAPON (By similarity). Interacts through its third PDZ domain with NLGN1 and CRIPT, and probably with NLGN2 and NLGN3 (PubMed:9278515). Interacts through its guanylate kinase-like domain with KIF13B (PubMed:10859302). Interacts through its guanylate kinase-like domain with DLGAP1/GKAP, DLGAP2, DLGAP3, DLGAP4, MAP1A, BEGAIN and SIPA1L1 (By similarity). Isoform 2 interacts through an L27 domain with HGS/HRS and the first L27 domain of CASK (PubMed:12151521). Interacts with ADR1B and ANKS1B (By similarity). May interact with HTR2A (By similarity). Interacts with ADAM22 (PubMed:27066583). Interacts with KLHL17 and LGI1 (By similarity). Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835). Interacts (via N-terminal tandem pair of PDZ domains) with GPER1 (via C-terminus tail motif); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner (By similarity). Interacts (via N-terminus tandem pair of PDZ domains) with NOS1 (via N-terminal domain) (By similarity). Interacts with SHANK3 (By similarity). Interacts with KCNJ4 (By similarity). Interacts with GPR85 (PubMed:25780553). Interacts with CACNG2 and MPP2 (via the SH3-Guanylate kinase-like sub-module) (By similarity). Interacts with ADGRB1 (PubMed:23782696). Found in a complex with PRR7 and GRIN1 (By similarity). Interacts (via PDZ3 domain and to lesser degree via PDZ2 domain) with PRR7 (By similarity). Component of the postsynaptic hippocampal AMPA-type glutamate receptor (AMPAR) complex, at least composed of pore forming AMPAR subunits GRIA1, GRIA2 and GRIA3 and AMPAR auxiliary proteins SHISA6 and SHISA7. Interacts (via its first two PDZ domains) with SHISA6 and SHISA7 (via PDZ-binding motif); the interaction is direct (By similarity).By similarity11 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi108086, 86 interactors
CORUMiP78352
DIPiDIP-30919N
IntActiP78352, 38 interactors
MINTiP78352
STRINGi9606.ENSP00000293813

Chemistry databases

BindingDBiP78352

Structurei

Secondary structure

1724
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP78352
SMRiP78352
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78352

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 151PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini160 – 246PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini313 – 393PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini428 – 498SH3PROSITE-ProRule annotationAdd BLAST71
Domaini534 – 709Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Domaini

The PDZ domain 3 mediates interaction with ADR1B.
The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000232102
HOVERGENiHBG107814
InParanoidiP78352
KOiK11828
OMAiQVEVHYA
OrthoDBiEOG091G0BB1
PhylomeDBiP78352
TreeFamiTF323171

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78352-1) [UniParc]FASTAAdd to basket
Also known as: PSD95-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDCLCIVTTK KYRYQDEDTP PLEHSPAHLP NQANSPPVIV NTDTLEAPGY
60 70 80 90 100
ELQVNGTEGE MEYEEITLER GNSGLGFSIA GGTDNPHIGD DPSIFITKII
110 120 130 140 150
PGGAAAQDGR LRVNDSILFV NEVDVREVTH SAAVEALKEA GSIVRLYVMR
160 170 180 190 200
RKPPAEKVME IKLIKGPKGL GFSIAGGVGN QHIPGDNSIY VTKIIEGGAA
210 220 230 240 250
HKDGRLQIGD KILAVNSVGL EDVMHEDAVA ALKNTYDVVY LKVAKPSNAY
260 270 280 290 300
LSDSYAPPDI TTSYSQHLDN EISHSSYLGT DYPTAMTPTS PRRYSPVAKD
310 320 330 340 350
LLGEEDIPRE PRRIVIHRGS TGLGFNIVGG EDGEGIFISF ILAGGPADLS
360 370 380 390 400
GELRKGDQIL SVNGVDLRNA SHEQAAIALK NAGQTVTIIA QYKPEEYSRF
410 420 430 440 450
EAKIHDLREQ LMNSSLGSGT ASLRSNPKRG FYIRALFDYD KTKDCGFLSQ
460 470 480 490 500
ALSFRFGDVL HVIDASDEEW WQARRVHSDS ETDDIGFIPS KRRVERREWS
510 520 530 540 550
RLKAKDWGSS SGSQGREDSV LSYETVTQME VHYARPIIIL GPTKDRANDD
560 570 580 590 600
LLSEFPDKFG SCVPHTTRPK REYEIDGRDY HFVSSREKME KDIQAHKFIE
610 620 630 640 650
AGQYNSHLYG TSVQSVREVA EQGKHCILDV SANAVRRLQA AHLHPIAIFI
660 670 680 690 700
RPRSLENVLE INKRITEEQA RKAFDRATKL EQEFTECFSA IVEGDSFEEI
710 720
YHKVKRVIED LSGPYIWVPA RERL
Length:724
Mass (Da):80,495
Last modified:August 2, 2005 - v3
Checksum:i7922D3F220F9A101
GO
Isoform 2 (identifier: P78352-2) [UniParc]FASTAAdd to basket
Also known as: PSD95-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MDCLCIVTTK → MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQ

Show »
Length:767
Mass (Da):85,430
Checksum:iBE1019159E65B2D8
GO
Isoform 3 (identifier: P78352-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-53: Missing.

Show »
Length:721
Mass (Da):80,125
Checksum:i608104D1BF7AE2C7
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
O14909O14909_HUMAN
Discs, large homolog 4 (Drosophila)...
DLG4 hCG_40530
296Annotation score:
C9JWP9C9JWP9_HUMAN
Disks large homolog 4
DLG4
234Annotation score:
C9JYG3C9JYG3_HUMAN
Disks large homolog 4
DLG4
281Annotation score:
K7EKP9K7EKP9_HUMAN
Disks large homolog 4
DLG4
115Annotation score:
K7EQM6K7EQM6_HUMAN
Disks large homolog 4
DLG4
85Annotation score:
K7EKU8K7EKU8_HUMAN
Disks large homolog 4
DLG4
91Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P78352-2)
Sequence conflicti46E → V in AAD56173 (PubMed:10582582).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0149291 – 10MDCLCIVTTK → MSQRPRAPRSALWLLAPPLL RWAPPLLTVLHSDLFQALLD ILDYYEASLSESQ in isoform 2. 1 Publication10
Alternative sequenceiVSP_04724751 – 53Missing in isoform 3. Curated3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U83192 mRNA Translation: AAC52113.1
AF156495 Genomic DNA Translation: AAD56173.1
AK293835 mRNA Translation: BAH11607.1
AC120057 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90255.1
U68138 mRNA Translation: AAB07736.1 Sequence problems.
CCDSiCCDS45599.1 [P78352-2]
CCDS45600.1 [P78352-3]
CCDS82050.1 [P78352-1]
PIRiT09599
RefSeqiNP_001122299.1, NM_001128827.2 [P78352-3]
NP_001308004.1, NM_001321075.1 [P78352-1]
NP_001356.1, NM_001365.4 [P78352-2]
UniGeneiHs.463928

Genome annotation databases

EnsembliENST00000302955; ENSP00000307471; ENSG00000132535 [P78352-3]
ENST00000399506; ENSP00000382425; ENSG00000132535 [P78352-1]
ENST00000399510; ENSP00000382428; ENSG00000132535 [P78352-2]
GeneIDi1742
KEGGihsa:1742
UCSCiuc002get.5 human [P78352-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U83192 mRNA Translation: AAC52113.1
AF156495 Genomic DNA Translation: AAD56173.1
AK293835 mRNA Translation: BAH11607.1
AC120057 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90255.1
U68138 mRNA Translation: AAB07736.1 Sequence problems.
CCDSiCCDS45599.1 [P78352-2]
CCDS45600.1 [P78352-3]
CCDS82050.1 [P78352-1]
PIRiT09599
RefSeqiNP_001122299.1, NM_001128827.2 [P78352-3]
NP_001308004.1, NM_001321075.1 [P78352-1]
NP_001356.1, NM_001365.4 [P78352-2]
UniGeneiHs.463928

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KEFNMR-A62-154[»]
2MESNMR-B1-71[»]
3I4WX-ray1.35A/B/C/D302-403[»]
3K82X-ray1.40A305-402[»]
3ZRTX-ray3.40A/B/C/D61-249[»]
5J7JNMR-B1-19[»]
5JXBX-ray2.90A/C309-413[»]
5OHWX-ray1.55A/B/C/D302-393[»]
5OI4X-ray1.50A/B/C/D302-403[»]
5OI6X-ray2.00A/B/C/D302-403[»]
5OIBX-ray1.50A/B/C/D/E/F305-403[»]
5OIGX-ray1.70A305-403[»]
5OIHX-ray1.05A305-402[»]
5OIIX-ray1.04A/B302-402[»]
5OIJX-ray1.80A/B302-403[»]
ProteinModelPortaliP78352
SMRiP78352
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108086, 86 interactors
CORUMiP78352
DIPiDIP-30919N
IntActiP78352, 38 interactors
MINTiP78352
STRINGi9606.ENSP00000293813

Chemistry databases

BindingDBiP78352
ChEMBLiCHEMBL5666
DrugBankiDB00536 Guanidine
DB01972 Guanosine-5'-Monophosphate

Protein family/group databases

MoonDBiP78352 Predicted
TCDBi8.A.24.1.3 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

PTM databases

iPTMnetiP78352
PhosphoSitePlusiP78352
SwissPalmiP78352

Polymorphism and mutation databases

BioMutaiDLG4
DMDMi71658825

Proteomic databases

EPDiP78352
MaxQBiP78352
PaxDbiP78352
PeptideAtlasiP78352
PRIDEiP78352
ProteomicsDBi57584
57585 [P78352-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302955; ENSP00000307471; ENSG00000132535 [P78352-3]
ENST00000399506; ENSP00000382425; ENSG00000132535 [P78352-1]
ENST00000399510; ENSP00000382428; ENSG00000132535 [P78352-2]
GeneIDi1742
KEGGihsa:1742
UCSCiuc002get.5 human [P78352-1]

Organism-specific databases

CTDi1742
DisGeNETi1742
EuPathDBiHostDB:ENSG00000132535.18
GeneCardsiDLG4
HGNCiHGNC:2903 DLG4
HPAiCAB001999
CAB002000
HPA010122
MIMi602887 gene
neXtProtiNX_P78352
OpenTargetsiENSG00000132535
PharmGKBiPA27359
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000232102
HOVERGENiHBG107814
InParanoidiP78352
KOiK11828
OMAiQVEVHYA
OrthoDBiEOG091G0BB1
PhylomeDBiP78352
TreeFamiTF323171

Enzyme and pathway databases

ReactomeiR-HSA-399719 Trafficking of AMPA receptors
R-HSA-438066 Unblocking of NMDA receptor, glutamate binding and activation
R-HSA-442729 CREB phosphorylation through the activation of CaMKII
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-5625900 RHO GTPases activate CIT
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-8849932 Synaptic adhesion-like molecules
SignaLinkiP78352
SIGNORiP78352

Miscellaneous databases

ChiTaRSiDLG4 human
EvolutionaryTraceiP78352
GeneWikiiDLG4
GenomeRNAii1742
PROiPR:P78352
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132535 Expressed in 146 organ(s), highest expression level in dorsolateral prefrontal cortex
CleanExiHS_DLG4
ExpressionAtlasiP78352 baseline and differential
GenevisibleiP78352 HS

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDLG4_HUMAN
AccessioniPrimary (citable) accession number: P78352
Secondary accession number(s): B7Z1S1
, G5E939, Q92941, Q9UKK8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: August 2, 2005
Last modified: October 10, 2018
This is version 212 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again