Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 223 (16 Oct 2019)
Sequence version 3 (02 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disks large homolog 4

Gene

DLG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Also regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1236394 Signaling by ERBB4
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-5625900 RHO GTPases activate CIT
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-8849932 Synaptic adhesion-like molecules
R-HSA-9609736 Assembly and cell surface presentation of NMDA receptors
R-HSA-9617324 Negative regulation of NMDA receptor-mediated neuronal transmission
R-HSA-9620244 Long-term potentiation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P78352

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P78352

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
P78352 Predicted

Transport Classification Database

More...
TCDBi
8.A.24.1.3 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large homolog 4
Alternative name(s):
Postsynaptic density protein 95Curated
Short name:
PSD-951 Publication
Synapse-associated protein 90
Short name:
SAP-90
Short name:
SAP90
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DLG4Imported
Synonyms:PSD95
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2903 DLG4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602887 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78352

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1742

Open Targets

More...
OpenTargetsi
ENSG00000132535

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27359

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P78352

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5666

Drug and drug target database

More...
DrugBanki
DB00536 Guanidine
DB01972 Guanosine-5'-Monophosphate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DLG4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
71658825

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945601 – 724Disks large homolog 4Add BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi3S-palmitoyl cysteineBy similarity1
Lipidationi5S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei73PhosphoserineBy similarity1
Modified residuei142PhosphoserineBy similarity1
Modified residuei240PhosphotyrosineBy similarity1
Modified residuei295PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei418PhosphoserineBy similarity1
Modified residuei420PhosphothreonineBy similarity1
Modified residuei422PhosphoserineBy similarity1
Modified residuei425PhosphoserineBy similarity1
Modified residuei449PhosphoserineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei580PhosphotyrosineBy similarity1
Modified residuei606PhosphoserineBy similarity1
Modified residuei654PhosphoserineBy similarity1
Modified residuei715PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated (PubMed:26701913). Palmitoylation is required for targeting to postsynaptic density, plasma membrane and synapses (By similarity). Palmitoylation may play a role in glutamate receptor GRIA1 synapse clustering (By similarity). Depalmitoylated by ABHD17A and ABHD17B and to a lesser extent by ABHD17C, ABHD12, ABHD13, LYPLA1 and LYPLA2 (PubMed:26701913). Undergoes rapid synaptic palmitoylation/depalmitoylation cycles during neuronal development which slow down in mature neurons (By similarity).By similarity1 Publication
Ubiquitinated by MDM2 in response to NMDA receptor activation, leading to proteasome-mediated degradation of DLG4 which is required for AMPA receptor endocytosis.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78352

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P78352

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P78352

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78352

PeptideAtlas

More...
PeptideAtlasi
P78352

PRoteomics IDEntifications database

More...
PRIDEi
P78352

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
33819
57584 [P78352-1]
57585 [P78352-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P78352

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78352

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P78352

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132535 Expressed in 146 organ(s), highest expression level in dorsolateral prefrontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P78352 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78352 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB001999
CAB002000
HPA010122

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts through its PDZ domains with ANO2 and NETO1 (By similarity).

Interacts through its first two PDZ domains with GRIN2A, GRIN2B, GRIN2C, GRIN2D (By similarity).

Interacts with ASIC3 (By similarity).

Interacts with SEMA4C (By similarity).

Interacts with CXADR (By similarity).

Interacts with KCND2 (By similarity).

Interacts with SYNGAP1 (By similarity).

Interacts with LRRC4 and LRRC4B (By similarity).

Interacts with ERBB4 (PubMed:10725395).

Interacts with KCNA1, KCNA2, KCNA3 and KCNA4 (PubMed:7477295).

Interacts through its first PDZ domain with GRIK2, KCNA4 and CRIPT (PubMed:11744724).

Interacts through its second PDZ domain with the PDZ domain of NOS1 or the C-terminus of CAPON (By similarity).

Interacts through its third PDZ domain with NLGN1 and CRIPT, and probably with NLGN2 and NLGN3 (PubMed:9278515).

Interacts through its guanylate kinase-like domain with KIF13B (PubMed:10859302).

Interacts through its guanylate kinase-like domain with DLGAP1/GKAP, DLGAP2, DLGAP3, DLGAP4, MAP1A, BEGAIN and SIPA1L1 (By similarity). Isoform 2 interacts through an L27 domain with HGS/HRS and the first L27 domain of CASK (PubMed:12151521).

Interacts with ADR1B and ANKS1B (By similarity). May interact with HTR2A (By similarity).

Interacts with ADAM22 (PubMed:27066583).

Interacts with KLHL17 and LGI1 (By similarity).

Interacts with FRMPD4 (via C-terminus) (PubMed:19118189).

Interacts with LRFN1, LRFN2 and LRFN4 (PubMed:16630835).

Interacts (via N-terminal tandem pair of PDZ domains) with GPER1 (via C-terminus tail motif); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner (By similarity).

Interacts (via N-terminus tandem pair of PDZ domains) with NOS1 (via N-terminal domain) (By similarity).

Interacts with SHANK3 (By similarity).

Interacts with KCNJ4 (By similarity).

Interacts with GPR85 (PubMed:25780553).

Interacts with CACNG2 and MPP2 (via the SH3-Guanylate kinase-like sub-module) (By similarity).

Interacts with ADGRB1 (PubMed:23782696).

Found in a complex with PRR7 and GRIN1 (By similarity).

Interacts (via PDZ3 domain and to lesser degree via PDZ2 domain) with PRR7 (By similarity).

Component of the postsynaptic hippocampal AMPA-type glutamate receptor (AMPAR) complex, at least composed of pore forming AMPAR subunits GRIA1, GRIA2 and GRIA3 and AMPAR auxiliary proteins SHISA6 and SHISA7.

Interacts (via its first two PDZ domains) with SHISA6 and SHISA7 (via PDZ-binding motif); the interaction is direct (By similarity).

Interacts with RPH3A and GRIN2A; this ternary complex regulates NMDA receptor composition at postsynaptic membranes (By similarity).

Interacts with ABR and BCR (PubMed:20962234).

By similarity12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108086, 91 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P78352

Database of interacting proteins

More...
DIPi
DIP-30919N

Protein interaction database and analysis system

More...
IntActi
P78352, 49 interactors

Molecular INTeraction database

More...
MINTi
P78352

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000382428

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P78352

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1724
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P78352

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P78352

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini65 – 151PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini160 – 246PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini313 – 393PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini428 – 498SH3PROSITE-ProRule annotationAdd BLAST71
Domaini534 – 709Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PDZ domain 3 mediates interaction with ADR1B.
The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0708 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157956

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232102

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78352

KEGG Orthology (KO)

More...
KOi
K11828

Identification of Orthologs from Complete Genome Data

More...
OMAi
SISESQX

Database of Orthologous Groups

More...
OrthoDBi
807583at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78352

TreeFam database of animal gene trees

More...
TreeFami
TF323171

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001741 MAGUK_DLGH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 16 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78352-1) [UniParc]FASTAAdd to basket
Also known as: PSD95-alpha

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDCLCIVTTK KYRYQDEDTP PLEHSPAHLP NQANSPPVIV NTDTLEAPGY
60 70 80 90 100
ELQVNGTEGE MEYEEITLER GNSGLGFSIA GGTDNPHIGD DPSIFITKII
110 120 130 140 150
PGGAAAQDGR LRVNDSILFV NEVDVREVTH SAAVEALKEA GSIVRLYVMR
160 170 180 190 200
RKPPAEKVME IKLIKGPKGL GFSIAGGVGN QHIPGDNSIY VTKIIEGGAA
210 220 230 240 250
HKDGRLQIGD KILAVNSVGL EDVMHEDAVA ALKNTYDVVY LKVAKPSNAY
260 270 280 290 300
LSDSYAPPDI TTSYSQHLDN EISHSSYLGT DYPTAMTPTS PRRYSPVAKD
310 320 330 340 350
LLGEEDIPRE PRRIVIHRGS TGLGFNIVGG EDGEGIFISF ILAGGPADLS
360 370 380 390 400
GELRKGDQIL SVNGVDLRNA SHEQAAIALK NAGQTVTIIA QYKPEEYSRF
410 420 430 440 450
EAKIHDLREQ LMNSSLGSGT ASLRSNPKRG FYIRALFDYD KTKDCGFLSQ
460 470 480 490 500
ALSFRFGDVL HVIDASDEEW WQARRVHSDS ETDDIGFIPS KRRVERREWS
510 520 530 540 550
RLKAKDWGSS SGSQGREDSV LSYETVTQME VHYARPIIIL GPTKDRANDD
560 570 580 590 600
LLSEFPDKFG SCVPHTTRPK REYEIDGRDY HFVSSREKME KDIQAHKFIE
610 620 630 640 650
AGQYNSHLYG TSVQSVREVA EQGKHCILDV SANAVRRLQA AHLHPIAIFI
660 670 680 690 700
RPRSLENVLE INKRITEEQA RKAFDRATKL EQEFTECFSA IVEGDSFEEI
710 720
YHKVKRVIED LSGPYIWVPA RERL
Length:724
Mass (Da):80,495
Last modified:August 2, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7922D3F220F9A101
GO
Isoform 2 (identifier: P78352-2) [UniParc]FASTAAdd to basket
Also known as: PSD95-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MDCLCIVTTK → MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQ

Show »
Length:767
Mass (Da):85,430
Checksum:iBE1019159E65B2D8
GO
Isoform 3 (identifier: P78352-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-53: Missing.

Show »
Length:721
Mass (Da):80,125
Checksum:i608104D1BF7AE2C7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 16 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B9EGL1B9EGL1_HUMAN
DLG4 protein
DLG4 hCG_40530
764Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z3U2B7Z3U2_HUMAN
Disks large homolog 4
DLG4
667Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IS17A0A3B3IS17_HUMAN
Disks large homolog 4
DLG4
697Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z647B7Z647_HUMAN
Discs, large homolog 4 (Drosophila)...
DLG4 hCG_40530
664Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISQ5A0A3B3ISQ5_HUMAN
Disks large homolog 4
DLG4
757Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
O14909O14909_HUMAN
Discs, large homolog 4 (Drosophila)...
DLG4 hCG_40530
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITI9A0A3B3ITI9_HUMAN
Disks large homolog 4
DLG4
277Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JWP9C9JWP9_HUMAN
Disks large homolog 4
DLG4
242Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JYG3C9JYG3_HUMAN
Disks large homolog 4
DLG4
242Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKP9K7EKP9_HUMAN
Disks large homolog 4
DLG4
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P78352-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46E → V in AAD56173 (PubMed:10582582).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0149291 – 10MDCLCIVTTK → MSQRPRAPRSALWLLAPPLL RWAPPLLTVLHSDLFQALLD ILDYYEASLSESQ in isoform 2. 1 Publication10
Alternative sequenceiVSP_04724751 – 53Missing in isoform 3. Curated3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U83192 mRNA Translation: AAC52113.1
AF156495 Genomic DNA Translation: AAD56173.1
AK293835 mRNA Translation: BAH11607.1
AC120057 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90255.1
U68138 mRNA Translation: AAB07736.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45599.1 [P78352-2]
CCDS45600.1 [P78352-3]
CCDS82050.1 [P78352-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T09599

NCBI Reference Sequences

More...
RefSeqi
NP_001122299.1, NM_001128827.2 [P78352-3]
NP_001308004.1, NM_001321075.1 [P78352-1]
NP_001356.1, NM_001365.4 [P78352-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000302955; ENSP00000307471; ENSG00000132535 [P78352-3]
ENST00000399506; ENSP00000382425; ENSG00000132535 [P78352-1]
ENST00000648172; ENSP00000497806; ENSG00000132535 [P78352-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1742

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1742

UCSC genome browser

More...
UCSCi
uc002get.5 human [P78352-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U83192 mRNA Translation: AAC52113.1
AF156495 Genomic DNA Translation: AAD56173.1
AK293835 mRNA Translation: BAH11607.1
AC120057 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90255.1
U68138 mRNA Translation: AAB07736.1 Sequence problems.
CCDSiCCDS45599.1 [P78352-2]
CCDS45600.1 [P78352-3]
CCDS82050.1 [P78352-1]
PIRiT09599
RefSeqiNP_001122299.1, NM_001128827.2 [P78352-3]
NP_001308004.1, NM_001321075.1 [P78352-1]
NP_001356.1, NM_001365.4 [P78352-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KEFNMR-A62-154[»]
2MESNMR-B1-71[»]
3I4WX-ray1.35A/B/C/D302-403[»]
3K82X-ray1.40A305-402[»]
3ZRTX-ray3.40A/B/C/D61-249[»]
5J7JNMR-B1-19[»]
5JXBX-ray2.90A/C309-413[»]
6QJDX-ray1.55A/B/C/D302-393[»]
6QJFX-ray1.50A/B/C/D302-403[»]
6QJGX-ray2.00A/B/C/D302-403[»]
6QJIX-ray1.50A/B/C/D/E/F305-403[»]
6QJJX-ray1.70A305-403[»]
6QJKX-ray1.05A305-402[»]
6QJLX-ray1.04A/B302-403[»]
6QJNX-ray1.80A/B302-403[»]
SMRiP78352
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi108086, 91 interactors
CORUMiP78352
DIPiDIP-30919N
IntActiP78352, 49 interactors
MINTiP78352
STRINGi9606.ENSP00000382428

Chemistry databases

BindingDBiP78352
ChEMBLiCHEMBL5666
DrugBankiDB00536 Guanidine
DB01972 Guanosine-5'-Monophosphate

Protein family/group databases

MoonDBiP78352 Predicted
TCDBi8.A.24.1.3 the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family

PTM databases

iPTMnetiP78352
PhosphoSitePlusiP78352
SwissPalmiP78352

Polymorphism and mutation databases

BioMutaiDLG4
DMDMi71658825

Proteomic databases

jPOSTiP78352
MassIVEiP78352
MaxQBiP78352
PaxDbiP78352
PeptideAtlasiP78352
PRIDEiP78352
ProteomicsDBi33819
57584 [P78352-1]
57585 [P78352-2]

Genome annotation databases

EnsembliENST00000302955; ENSP00000307471; ENSG00000132535 [P78352-3]
ENST00000399506; ENSP00000382425; ENSG00000132535 [P78352-1]
ENST00000648172; ENSP00000497806; ENSG00000132535 [P78352-2]
GeneIDi1742
KEGGihsa:1742
UCSCiuc002get.5 human [P78352-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1742
DisGeNETi1742

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DLG4
HGNCiHGNC:2903 DLG4
HPAiCAB001999
CAB002000
HPA010122
MIMi602887 gene
neXtProtiNX_P78352
OpenTargetsiENSG00000132535
PharmGKBiPA27359

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0708 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000157956
HOGENOMiHOG000232102
InParanoidiP78352
KOiK11828
OMAiSISESQX
OrthoDBi807583at2759
PhylomeDBiP78352
TreeFamiTF323171

Enzyme and pathway databases

ReactomeiR-HSA-1236394 Signaling by ERBB4
R-HSA-399719 Trafficking of AMPA receptors
R-HSA-438066 Unblocking of NMDA receptors, glutamate binding and activation
R-HSA-442982 Ras activation upon Ca2+ influx through NMDA receptor
R-HSA-447038 NrCAM interactions
R-HSA-451308 Activation of Ca-permeable Kainate Receptor
R-HSA-5625900 RHO GTPases activate CIT
R-HSA-5673001 RAF/MAP kinase cascade
R-HSA-5682910 LGI-ADAM interactions
R-HSA-6794361 Neurexins and neuroligins
R-HSA-8849932 Synaptic adhesion-like molecules
R-HSA-9609736 Assembly and cell surface presentation of NMDA receptors
R-HSA-9617324 Negative regulation of NMDA receptor-mediated neuronal transmission
R-HSA-9620244 Long-term potentiation
SignaLinkiP78352
SIGNORiP78352

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DLG4 human
EvolutionaryTraceiP78352

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DLG4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1742
PharosiP78352

Protein Ontology

More...
PROi
PR:P78352

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132535 Expressed in 146 organ(s), highest expression level in dorsolateral prefrontal cortex
ExpressionAtlasiP78352 baseline and differential
GenevisibleiP78352 HS

Family and domain databases

InterProiView protein in InterPro
IPR016313 DLG1-like
IPR019590 DLG1_PEST_dom
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR019583 PDZ_assoc
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF10608 MAGUK_N_PEST, 1 hit
PF00595 PDZ, 3 hits
PF10600 PDZ_assoc, 1 hit
PF00018 SH3_1, 1 hit
PIRSFiPIRSF001741 MAGUK_DLGH, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM01277 MAGUK_N_PEST, 1 hit
SM00228 PDZ, 3 hits
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 3 hits
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 3 hits
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLG4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78352
Secondary accession number(s): B7Z1S1
, G5E939, Q92941, Q9UKK8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: August 2, 2005
Last modified: October 16, 2019
This is version 223 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again