UniProtKB - P78345 (RPP38_HUMAN)

BLAST

>sp|P78345|RPP38_HUMAN Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2
MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKI
EDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV
TRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLAL
AFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLS
KPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK

Align
Format
Add to basket Added to basket
History
Entry version 160 (07 Nov 2018)
Sequence version 2 (06 Dec 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Ribonuclease P protein subunit p38

Gene

RPP38

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. RPP38 may associate transiently with RNase P RNA as a factor involved in the transport of H1 RNA to the putative site of its assembly in the cell, the nucleolus.

Miscellaneous

Autoantibodies against RPP38 are found in sera from scleroderma patients.

Catalytic activityⁱ

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

GO - Molecular functionⁱ

ribonuclease P activity
Source: ProtInc
Traceable author statementⁱ
- 9630247

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

tRNA processing Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Hydrolase
Biological process	tRNA processing

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6784531 tRNA processing in the nucleus R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Reactomeⁱ

R-HSA-6784531 tRNA processing in the nucleus
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Ribonuclease P protein subunit p38 (EC:3.1.26.5) Short name: RNaseP protein p38
Gene namesⁱ	Name:RPP38
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 10

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000152464.14
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:30329 RPP38
MIMⁱ	606116 gene
neXtProtⁱ	NX_P78345

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	10557
Open Targets More...OpenTargetsⁱ	ENSG00000152464
PharmGKBⁱ	PA134957031

Polymorphism and mutation databases

BioMutaⁱ	RPP38
DMDMⁱ	83305638

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000136783	2 – 283	Ribonuclease P protein subunit p38Add BLAST		282

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylalanineCombined sources	1
Modified residueⁱ	12	PhosphoserineCombined sources	1
Modified residueⁱ	226	PhosphoserineCombined sources	1
Modified residueⁱ	235	PhosphoserineCombined sources	1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	P78345
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P78345
PaxDbⁱ	P78345
PeptideAtlas More...PeptideAtlasⁱ	P78345
PRIDEⁱ	P78345
ProteomicsDBⁱ	57576

PTM databases

iPTMnetⁱ	P78345
PhosphoSitePlusⁱ	P78345

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000152464 Expressed in 219 organ(s), highest expression level in testis
CleanExⁱ	HS_RPP38
ExpressionAtlasⁱ	P78345 baseline and differential
Genevisibleⁱ	P78345 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA045128 HPA050398

HPAⁱ

HPA045128
HPA050398

Interactionⁱ

Subunit structureⁱ

RNase P consists of an RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40. RPP38 is probably a dimer.

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
NCK1	P16333	2	EBI-366493,EBI-389883
POP4	O95707	2	EBI-366493,EBI-366477

Protein-protein interaction databases

BioGridⁱ	115808, 56 interactors
CORUMⁱ	P78345
IntActⁱ	P78345, 23 interactors
STRINGⁱ	9606.ENSP00000367439

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P78345
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	63 – 68	Poly-Lys		6

Sequence similaritiesⁱ

Belongs to the eukaryotic ribosomal protein eL8 family.Curated

Phylogenomic databases

eggNOGⁱ	KOG3387 Eukaryota COG1358 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000007526
HOGENOMⁱ	HOG000231566
HOVERGENⁱ	HBG060241
InParanoidⁱ	P78345
KEGG Orthology (KO) More...KOⁱ	K14523
OMAⁱ	PWLQDRT
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0INQ
PhylomeDBⁱ	P78345
TreeFamⁱ	TF332558

Family and domain databases

Gene3Dⁱ	3.30.1330.30, 1 hit
InterProⁱ	View protein in InterPro IPR029064 L30e-like IPR004038 Ribosomal_L7Ae/L30e/S12e/Gad45
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01248 Ribosomal_L7Ae, 1 hit
SUPFAMⁱ	SSF55315 SSF55315, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

P78345-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MAAAPQAPGR GSLRKTRPLV VKTSLNNPYI IRWSALESED MHFILQTLED 
        60         70         80         90        100
RLKAIGLQKI EDKKKKNKTP FLKKESREKC SIAVDISENL KEKKTDAKQQ 
       110        120        130        140        150
VSGWTPAHVR KQLAIGVNEV TRALERRELL LVLVCKSVKP AMITSHLIQL 
       160        170        180        190        200
SLSRSVPACQ VPRLSERIAP VIGLKCVLAL AFKKNTTDFV DEVRAIIPRV 
       210        220        230        240        250
PSLSVPWLQD RIEDSGENLE TEPLESQDRE LLDTSFEDLS KPKRKLADGR 
       260        270        280 
QASVTLQPLK IKKLIPNPNK IRKPPKSKKA TPK

Length:283

Mass (Da):31,834

Last modified:December 6, 2005 - v2

Checksum:ⁱ233F3397DBDE4F18

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q5VUC3	Q5VUC3_HUMAN	Ribonuclease P protein subunit p38 Ribonuclease P protein subunit p38	RPP38	168	Annotation score:
Q5VUC9	Q5VUC9_HUMAN	Ribonuclease P protein subunit p38 Ribonuclease P protein subunit p38	RPP38	145	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	24	S → A AA sequence (PubMed:9037013).Curated		1

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_051811	86	I → V. Corresponds to variant dbSNP:rs3814171Ensembl.	1
Natural variantⁱVAR_023960	88	E → D. Corresponds to variant dbSNP:rs1052157Ensembl.	1
Natural variantⁱVAR_023961	114	A → V1 PublicationCorresponds to variant dbSNP:rs1132078Ensembl.	1
Natural variantⁱVAR_023962	181	A → G2 PublicationsCorresponds to variant dbSNP:rs15772Ensembl.	1
Natural variantⁱVAR_051812	202	S → R. Corresponds to variant dbSNP:rs12249258Ensembl.	1
Natural variantⁱVAR_029298	212	I → T. Corresponds to variant dbSNP:rs10242Ensembl.	1
Natural variantⁱVAR_051813	250	R → G. Corresponds to variant dbSNP:rs34040166Ensembl.	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U77664 mRNA Translation: AAC51142.1 AK057006 mRNA Translation: BAG51842.1 CR541816 mRNA Translation: CAG46615.1 AK223418 mRNA Translation: BAD97138.1 AL590365 Genomic DNA No translation available. CH471072 Genomic DNA Translation: EAW86240.1 CH471072 Genomic DNA Translation: EAW86241.1 BC029494 mRNA Translation: AAH29494.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS7108.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001091059.1, NM_001097590.2 NP_001252530.1, NM_001265601.1 NP_006405.2, NM_006414.4 NP_892117.1, NM_183005.4 XP_006717426.1, XM_006717363.1 XP_006717427.1, XM_006717364.3 XP_011517595.1, XM_011519293.1 XP_016870968.1, XM_017015479.1 XP_016870969.1, XM_017015480.1 XP_016870970.1, XM_017015481.1
UniGeneⁱ	Hs.94986

Genome annotation databases

Ensemblⁱ	ENST00000378197; ENSP00000367439; ENSG00000152464 ENST00000378202; ENSP00000367444; ENSG00000152464 ENST00000378203; ENSP00000367445; ENSG00000152464 ENST00000616640; ENSP00000478982; ENSG00000152464
GeneIDⁱ	10557
KEGGⁱ	hsa:10557
UCSC genome browser More...UCSCⁱ	uc001inx.6 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P78345	Ribonuclease P protein subunit p38 (Fragment)		HUMAN		168	UniRef100_P78345

Protein	Similar proteins		Species	Score	Length	Source
P78345	Ribonuclease P protein subunit p38 (Fragment)		HUMAN		168	UniRef90_P78345
Ribonuclease P/MRP subunit p38		PANTR		311
Ribonuclease P/MRP subunit p38		PANPA		311
RPP38 isoform 1		PONAB		283
Ribonuclease P protein subunit p38		MACMU		282
+19

Protein	Similar proteins		Species	Score	Length	Source
P78345	Ribonuclease P protein subunit p38 (Fragment)		HUMAN		168	UniRef50_P78345
Ribonuclease P/MRP subunit p38		PANTR		311
Ribonuclease P/MRP subunit p38		PANPA		311
RPP38 isoform 1		PONAB		283
Ribonuclease P protein subunit p38		CALJA		282
+114

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U77664 mRNA Translation: AAC51142.1 AK057006 mRNA Translation: BAG51842.1 CR541816 mRNA Translation: CAG46615.1 AK223418 mRNA Translation: BAD97138.1 AL590365 Genomic DNA No translation available. CH471072 Genomic DNA Translation: EAW86240.1 CH471072 Genomic DNA Translation: EAW86241.1 BC029494 mRNA Translation: AAH29494.1
CCDSⁱ	CCDS7108.1
RefSeqⁱ	NP_001091059.1, NM_001097590.2 NP_001252530.1, NM_001265601.1 NP_006405.2, NM_006414.4 NP_892117.1, NM_183005.4 XP_006717426.1, XM_006717363.1 XP_006717427.1, XM_006717364.3 XP_011517595.1, XM_011519293.1 XP_016870968.1, XM_017015479.1 XP_016870969.1, XM_017015480.1 XP_016870970.1, XM_017015481.1
UniGeneⁱ	Hs.94986

3D structure databases

ProteinModelPortalⁱ	P78345
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	115808, 56 interactors
CORUMⁱ	P78345
IntActⁱ	P78345, 23 interactors
STRINGⁱ	9606.ENSP00000367439

PTM databases

iPTMnetⁱ	P78345
PhosphoSitePlusⁱ	P78345

Polymorphism and mutation databases

BioMutaⁱ	RPP38
DMDMⁱ	83305638

Proteomic databases

EPDⁱ	P78345
MaxQBⁱ	P78345
PaxDbⁱ	P78345
PeptideAtlasⁱ	P78345
PRIDEⁱ	P78345
ProteomicsDBⁱ	57576

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	10557
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000378197; ENSP00000367439; ENSG00000152464 ENST00000378202; ENSP00000367444; ENSG00000152464 ENST00000378203; ENSP00000367445; ENSG00000152464 ENST00000616640; ENSP00000478982; ENSG00000152464
GeneIDⁱ	10557
KEGGⁱ	hsa:10557
UCSCⁱ	uc001inx.6 human

Organism-specific databases

CTDⁱ	10557
DisGeNETⁱ	10557
EuPathDBⁱ	HostDB:ENSG00000152464.14
GeneCardsⁱ	RPP38
HGNCⁱ	HGNC:30329 RPP38
HPAⁱ	HPA045128 HPA050398
MIMⁱ	606116 gene
neXtProtⁱ	NX_P78345
OpenTargetsⁱ	ENSG00000152464
PharmGKBⁱ	PA134957031
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG3387 Eukaryota COG1358 LUCA
GeneTreeⁱ	ENSGT00390000007526
HOGENOMⁱ	HOG000231566
HOVERGENⁱ	HBG060241
InParanoidⁱ	P78345
KOⁱ	K14523
OMAⁱ	PWLQDRT
OrthoDBⁱ	EOG091G0INQ
PhylomeDBⁱ	P78345
TreeFamⁱ	TF332558

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6784531 tRNA processing in the nucleus R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Reactomeⁱ

R-HSA-6784531 tRNA processing in the nucleus
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Miscellaneous databases

ChiTaRSⁱ	RPP38 human
GeneWikiⁱ	RPP38
GenomeRNAiⁱ	10557
Protein Ontology More...PROⁱ	PR:P78345
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000152464 Expressed in 219 organ(s), highest expression level in testis
CleanExⁱ	HS_RPP38
ExpressionAtlasⁱ	P78345 baseline and differential
Genevisibleⁱ	P78345 HS

Family and domain databases

Gene3Dⁱ	3.30.1330.30, 1 hit
InterProⁱ	View protein in InterPro IPR029064 L30e-like IPR004038 Ribosomal_L7Ae/L30e/S12e/Gad45
Pfamⁱ	View protein in Pfam PF01248 Ribosomal_L7Ae, 1 hit
SUPFAMⁱ	SSF55315 SSF55315, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RPP38_HUMAN
Accessionⁱ	P78345Primary (citable) accession number: P78345 Secondary accession number(s): B3KPY0 , D3DRT8, Q53F71, Q8NHS8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	February 21, 2001
	Last sequence update:	December 6, 2005
	Last modified:	November 7, 2018
	This is version 160 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Direct protein sequencing, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Ribosomal proteins
Ribosomal proteins families and list of entries
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
Human chromosome 10
Human chromosome 10: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P78345 (RPP38_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Ribonuclease P protein subunit p38

RPP38

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ