Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 190 (07 Apr 2021)
Sequence version 1 (01 May 1997)
Previous versions | rss
Add a publicationFeedback
Protein

Cytochrome P450 4F2

Gene

CYP4F2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, eicosanoids and vitamins (PubMed:18577768, PubMed:10833273, PubMed:10660572, PubMed:11997390, PubMed:17341693, PubMed:18574070). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase). Catalyzes predominantly the oxidation of the terminal carbon (omega-oxidation) of long- and very long-chain fatty acids. Displays high omega-hydroxylase activity toward polyunsaturated fatty acids (PUFAs) (PubMed:18577768). Participates in the conversion of arachidonic acid to omega-hydroxyeicosatetraenoic acid (20-HETE), a signaling molecule acting both as vasoconstrictive and natriuretic with overall effect on arterial blood pressure (PubMed:10660572, PubMed:17341693, PubMed:18574070). Plays a role in the oxidative inactivation of eicosanoids, including both proinflammatory and anti-inflammatory mediators such as leukotriene B4 (LTB4), lipoxin A4 (LXA4), and several HETEs (PubMed:8026587, PubMed:9799565, PubMed:10833273, PubMed:10660572, PubMed:17341693, PubMed:18574070, PubMed:18577768). Catalyzes omega-hydroxylation of 3-hydroxy fatty acids (PubMed:18065749). Converts monoepoxides of linoleic acid leukotoxin and isoleukotoxin to omega-hydroxylated metabolites (PubMed:15145985). Contributes to the degradation of very long-chain fatty acids (VLCFAs) by catalyzing successive omega-oxidations and chain shortening (PubMed:16547005, PubMed:18182499). Plays an important role in vitamin metabolism by chain shortening. Catalyzes omega-hydroxylation of the phytyl chain of tocopherols (forms of vitamin E), with preference for gamma-tocopherols over alpha-tocopherols, thus promoting retention of alpha-tocopherols in tissues (PubMed:11997390). Omega-hydroxylates and inactivates phylloquinone (vitamin K1), and menaquinone-4 (MK-4, a form of vitamin K2), both acting as cofactors in blood coagulation (PubMed:19297519, PubMed:24138531).14 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

hemeBy similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by dietary sesamin.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

kcat is 0.067 min(-1) with menaquinone-4 (MK-4) as substrate (PubMed:24138531). The omega-hydroxylation of VLCFAs follows dual-enzyme Michaelis-Menten kinetics, suggesting simultaneous binding of two substrate molecules. The high affinity Michaelis-Menten constants are shown (PubMed:16547005).2 Publications
  1. KM=0.5 µM for docosanoate1 Publication
  2. KM=1.1 µM for tetracosanoate1 Publication
  3. KM=1.9 µM for hexacosanoate1 Publication
  4. KM=75.2 µM for 12-hydroxyoctadecanoate1 Publication
  5. KM=19 µM for 8-HETE1 Publication
  6. KM=42.3 µM for 12-HETE1 Publication
  7. KM=37.6 µM for 22-hydroxydocosanoate1 Publication
  8. KM=8.8 µM for 26-hydroxyhexacosanoate1 Publication
  9. KM=26.1 µM for 9(10)-epoxyoctadecanoate1 Publication
  10. KM=163.1 µM for 9(10)-epoxy-(12Z)-octadecenoate1 Publication
  11. KM=135 µM for 12(13)-epoxy-(9Z)-octadecenoate1 Publication
  12. KM=60 µM for leukotriene B41 Publication
  13. KM=55.6 µM for 6-trans-leukotriene B41 Publication
  14. KM=58.2 µM for lipoxin A41 Publication
  15. KM=1.7 µM for menaquinone-4 (MK-4)1 Publication
  16. KM=21 µM for alpha-tocopherol1 Publication
  17. KM=37 µM for gamma-tocopherol1 Publication
  1. Vmax=1.6 pmol/min/pmol enzyme toward docosanoate1 Publication
  2. Vmax=1.6 pmol/min/pmol enzyme toward tetracosanoate1 Publication
  3. Vmax=0.9 pmol/min/pmol enzyme toward hexacosanoate1 Publication
  4. Vmax=7 nmol/min/nmol enzyme toward 12-hydroxyoctadecanoate1 Publication
  5. Vmax=4 nmol/min/nmol enzyme toward 8-HETE1 Publication
  6. Vmax=2.9 nmol/min/nmol enzyme toward 12-HETE1 Publication
  7. Vmax=1.6 pmol/min/pmol enzyme toward 22-hydroxydocosanoate1 Publication
  8. Vmax=0.7 pmol/min/pmol enzyme toward 26-hydroxyhexacosanoate1 Publication
  9. Vmax=7.9 nmol/min/nmol enzyme toward 9(10)-epoxyoctadecanoate1 Publication
  10. Vmax=10.6 nmol/min/nmol enzyme toward 9(10)-epoxy-(12Z)-octadecenoate1 Publication
  11. Vmax=0.84 nmol/min/nmol enzyme toward 12(13)-epoxy-(9Z)-octadecenoate1 Publication
  12. Vmax=2.7 nmol/min/nmol enzyme toward leukotriene B41 Publication
  13. Vmax=11.9 nmol/min/nmol enzyme toward 6-trans-leukotriene B41 Publication
  14. Vmax=5.5 nmol/min/nmol enzyme toward lipoxin A41 Publication
  15. Vmax=0.16 nmol/min/nmol enzyme toward alpha-tocopherol1 Publication
  16. Vmax=1.99 nmol/min/nmol enzyme toward gamma-tocopherol1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: arachidonate metabolism

This protein is involved in the pathway arachidonate metabolism, which is part of Lipid metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway arachidonate metabolism and in Lipid metabolism.

Pathwayi: leukotriene B4 degradation

This protein is involved in the pathway leukotriene B4 degradation, which is part of Lipid metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway leukotriene B4 degradation and in Lipid metabolism.

Pathwayi: phylloquinone degradation

This protein is involved in the pathway phylloquinone degradation, which is part of Cofactor degradation.1 Publication
View all proteins of this organism that are known to be involved in the pathway phylloquinone degradation and in Cofactor degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei328Heme; covalent, via 1 linkBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi468Iron (heme axial ligand)By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
Biological processFatty acid metabolism, Lipid metabolism
LigandHeme, Iron, Metal-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS02675-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.14.13.30, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P78329

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-211935, Fatty acids
R-HSA-211958, Miscellaneous substrates
R-HSA-211979, Eicosanoids
R-HSA-2142691, Synthesis of Leukotrienes (LT) and Eoxins (EX)
R-HSA-2142816, Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE)

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00383
UPA00883
UPA01054

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000421

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytochrome P450 4F21 Publication (EC:1.14.14.14 Publications)
Alternative name(s):
20-hydroxyeicosatetraenoic acid synthase1 Publication
Short name:
20-HETE synthase1 Publication
Arachidonic acid omega-hydroxylase1 Publication
CYPIVF2
Cytochrome P450-LTB-omega
Docosahexaenoic acid omega-hydroxylase (EC:1.14.14.791 Publication)
Leukotriene-B(4) 20-monooxygenase 1
Leukotriene-B(4) omega-hydroxylase 1Curated (EC:1.14.14.942 Publications)
Phylloquinone omega-hydroxylase CYP4F2Curated (EC:1.14.14.781 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CYP4F21 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2645, CYP4F2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604426, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78329

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000186115.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Coumarin resistance (CMRES)7 Publications
Disease susceptibility may be associated with variants affecting the gene represented in this entry. The variant Met-433 is associated with coumarin (the brand name of warfarin) resistance by increasing coumarin maintenance dose in patients on this anti-coagulant therapy. This is probably due to decreased activity of the phylloquinone omega-hydroxylase activity, leading to an increase in hepatic vitamin K levels that warfarin must antagonize (PubMed:24138531).1 Publication
Disease descriptionA condition characterized by partial or complete resistance to warfarin or other 4-hydroxycoumarin derivatives. These drugs are used as anti-coagulants for the prevention of thromboembolic diseases in subjects with deep vein thrombosis, atrial fibrillation, or mechanical heart valve replacement.
Related information in OMIM

Organism-specific databases

DisGeNET

More...
DisGeNETi
8529
MIMi122700, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000186115

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
413674, Vitamin K antagonists toxicity or dose selection

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27121

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P78329, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3379

Drug and drug target database

More...
DrugBanki
DB14003, alpha-Tocopherol acetate
DB08868, Fingolimod
DB09148, Florbetaben (18F)
DB01026, Ketoconazole
DB09568, Omega-3-carboxylic acids
DB11635, Tocofersolan
DB11251, Tocopherol

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1344

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CYP4F2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
6166044

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00004305811 – 41 Publication4
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000518505 – 520Cytochrome P450 4F2Add BLAST516

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78329

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P78329

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P78329

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78329

PeptideAtlas

More...
PeptideAtlasi
P78329

PRoteomics IDEntifications database

More...
PRIDEi
P78329

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5249
57568 [P78329-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P78329

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78329

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Liver. Also present in kidney: specifically expressed in the S2 and S3 segments of proximal tubules in cortex and outer medulla (PubMed:10660572).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186115, Expressed in caput epididymis and 113 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P78329, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78329, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000186115, Group enriched (intestine, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
P78329
With#Exp.IntAct
AQP6 [Q13520]3EBI-1752413,EBI-13059134
CPLX4 [Q7Z7G2]3EBI-1752413,EBI-18013275
CREB3 - isoform 1 [O43889-2]3EBI-1752413,EBI-625022
CREB3L1 [Q96BA8]3EBI-1752413,EBI-6942903
DNAJC1 [Q96KC8]3EBI-1752413,EBI-296550
EBP [Q15125]3EBI-1752413,EBI-3915253
ELOVL4 [Q9GZR5]3EBI-1752413,EBI-18535450
ERGIC3 [Q9Y282]3EBI-1752413,EBI-781551
FAM210B [Q96KR6]3EBI-1752413,EBI-18938272
GJA8 [P48165]3EBI-1752413,EBI-17458373
HSD17B13 [Q7Z5P4]3EBI-1752413,EBI-18053395
JAGN1 [Q8N5M9]3EBI-1752413,EBI-10266796
LEPROTL1 [O95214]3EBI-1752413,EBI-750776
MMD [Q15546]3EBI-1752413,EBI-17873222
MTIF3 [Q9H2K0]3EBI-1752413,EBI-3923617
MUC1 - isoform Y-LSP [P15941-11]3EBI-1752413,EBI-17263240
NCK1 [P16333]2EBI-1752413,EBI-389883
PGRMC2 [O15173]3EBI-1752413,EBI-1050125
PLEKHO1 [Q53GL0]3EBI-1752413,EBI-949945
REEP2 [Q9BRK0]3EBI-1752413,EBI-11337973
REEP4 [Q9H6H4]3EBI-1752413,EBI-7545592
RETREG3 [Q86VR2]3EBI-1752413,EBI-10192441
ROM1 [Q03395]3EBI-1752413,EBI-9395257
SCN3B [Q9NY72]3EBI-1752413,EBI-17247926
SDHAF2 [Q9NX18]3EBI-1752413,EBI-713250
SLC10A6 [Q3KNW5]3EBI-1752413,EBI-18159983
SLC17A8 - isoform 2 [Q8NDX2-2]3EBI-1752413,EBI-17249797
SLC19A3 [Q9BZV2]3EBI-1752413,EBI-3923779
SLC2A13 [Q96QE2]3EBI-1752413,EBI-18082698
SPAG4 [Q9NPE6]3EBI-1752413,EBI-10819434
THAP4 [Q8WY91]3EBI-1752413,EBI-726691
TLCD4 [Q96MV1]3EBI-1752413,EBI-12947623
TM4SF19 [Q96DZ7]3EBI-1752413,EBI-6448756
TMEM51 [Q9NW97]3EBI-1752413,EBI-726044
TMX2 [Q9Y320]3EBI-1752413,EBI-6447886
TSPAN31 [Q12999]3EBI-1752413,EBI-17678331
UBE2I [Q7KZS0]3EBI-1752413,EBI-10180829
ZDHHC15 [Q96MV8]3EBI-1752413,EBI-12837904

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
114099, 37 interactors

Protein interaction database and analysis system

More...
IntActi
P78329, 44 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000221700

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P78329

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P78329, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P78329

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0157, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154646

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001570_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78329

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECCTEMI

Database of Orthologous Groups

More...
OrthoDBi
1247045at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78329

TreeFam database of animal gene trees

More...
TreeFami
TF105088

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.630.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR002401, Cyt_P450_E_grp-I
IPR036396, Cyt_P450_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00067, p450, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00463, EP450I
PR00385, P450

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48264, SSF48264, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78329-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQLSLSWLG LWPVAASPWL LLLLVGASWL LAHVLAWTYA FYDNCRRLRC
60 70 80 90 100
FPQPPRRNWF WGHQGMVNPT EEGMRVLTQL VATYPQGFKV WMGPISPLLS
110 120 130 140 150
LCHPDIIRSV INASAAIAPK DKFFYSFLEP WLGDGLLLSA GDKWSRHRRM
160 170 180 190 200
LTPAFHFNIL KPYMKIFNES VNIMHAKWQL LASEGSACLD MFEHISLMTL
210 220 230 240 250
DSLQKCVFSF DSHCQEKPSE YIAAILELSA LVSKRHHEIL LHIDFLYYLT
260 270 280 290 300
PDGQRFRRAC RLVHDFTDAV IQERRRTLPS QGVDDFLQAK AKSKTLDFID
310 320 330 340 350
VLLLSKDEDG KKLSDEDIRA EADTFMFEGH DTTASGLSWV LYHLAKHPEY
360 370 380 390 400
QERCRQEVQE LLKDREPKEI EWDDLAHLPF LTMCMKESLR LHPPVPVISR
410 420 430 440 450
HVTQDIVLPD GRVIPKGIIC LISVFGTHHN PAVWPDPEVY DPFRFDPENI
460 470 480 490 500
KERSPLAFIP FSAGPRNCIG QTFAMAEMKV VLALTLLRFR VLPDHTEPRR
510 520
KPELVLRAEG GLWLRVEPLS
Length:520
Mass (Da):59,853
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1791F9E6EECB59B5
GO
Isoform 2 (identifier: P78329-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: Missing.
     307-339: DEDGKKLSDEDIRAEADTFMFEGHDTTASGLSW → AMTPRPVVSPGSCTTLQSTQNTRSAAGRRCKNF
     340-520: Missing.

Show »
Length:190
Mass (Da):21,709
Checksum:iE137B6FDB0B39573
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EK90K7EK90_HUMAN
Cytochrome P450 4F2
CYP4F2
153Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MQR0A0A0A0MQR0_HUMAN
Cytochrome P450 4F2
CYP4F2 hCG_1788543
520Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQI8K7EQI8_HUMAN
Cytochrome P450 4F2
CYP4F2
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EPM0K7EPM0_HUMAN
Cytochrome P450 4F2
CYP4F2
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12 – 13WP → CR in AAC50052 (Ref. 3) Curated2
Sequence conflicti12 – 13WP → CR in AAF86378 (PubMed:10860554).Curated2
Sequence conflicti25V → A in AAH67437 (PubMed:15489334).Curated1
Sequence conflicti169E → D in AAH67440 (PubMed:15489334).Curated1
Sequence conflicti336G → V in AAC50052 (Ref. 3) Curated1
Sequence conflicti391L → V in AAC50052 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0131167S → Y1 PublicationCorresponds to variant dbSNP:rs3093104Ensembl.1
Natural variantiVAR_01311712W → G3 PublicationsCorresponds to variant dbSNP:rs3093105Ensembl.1
Natural variantiVAR_013118185G → V2 PublicationsCorresponds to variant dbSNP:rs3093153Ensembl.1
Natural variantiVAR_020125269A → D. Corresponds to variant dbSNP:rs1805040Ensembl.1
Natural variantiVAR_013119433V → M Associated with coumarin resistance; increased warfarin maintenance dose in patients on warfarin anti-coagulant therapy due to decreased vitamin K catabolism; decreased phylloquinone omega-hydroxylase activity; decreased production of 20-hydroxyeicosatetraenoic acid (20-HETE). 10 PublicationsCorresponds to variant dbSNP:rs2108622EnsemblClinVar.1
Natural variantiVAR_013120519L → M1 PublicationCorresponds to variant dbSNP:rs3093200Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0555781 – 149Missing in isoform 2. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_055579307 – 339DEDGK…SGLSW → AMTPRPVVSPGSCTTLQSTQ NTRSAAGRRCKNF in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_055580340 – 520Missing in isoform 2. 1 PublicationAdd BLAST181

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D26480 mRNA Translation: BAA05490.1
AB015306 Genomic DNA Translation: BAA75823.1
U02388 mRNA Translation: AAC50052.2
AK290790 mRNA Translation: BAF83479.1
AK300961 mRNA Translation: BAG62587.1
AF467894 Genomic DNA Translation: AAL67578.1
AC005336 Genomic DNA Translation: AAC27730.1
AC004791 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84509.1
CH471106 Genomic DNA Translation: EAW84510.1
BC067437 mRNA Translation: AAH67437.1
BC067439 mRNA Translation: AAH67439.1
BC067440 mRNA Translation: AAH67440.1
AF221943 Genomic DNA Translation: AAF86378.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12336.1 [P78329-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S45702

NCBI Reference Sequences

More...
RefSeqi
NP_001073.3, NM_001082.4 [P78329-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000221700; ENSP00000221700; ENSG00000186115 [P78329-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8529

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8529

UCSC genome browser

More...
UCSCi
uc002nbs.2, human [P78329-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D26480 mRNA Translation: BAA05490.1
AB015306 Genomic DNA Translation: BAA75823.1
U02388 mRNA Translation: AAC50052.2
AK290790 mRNA Translation: BAF83479.1
AK300961 mRNA Translation: BAG62587.1
AF467894 Genomic DNA Translation: AAL67578.1
AC005336 Genomic DNA Translation: AAC27730.1
AC004791 Genomic DNA No translation available.
CH471106 Genomic DNA Translation: EAW84509.1
CH471106 Genomic DNA Translation: EAW84510.1
BC067437 mRNA Translation: AAH67437.1
BC067439 mRNA Translation: AAH67439.1
BC067440 mRNA Translation: AAH67440.1
AF221943 Genomic DNA Translation: AAF86378.1
CCDSiCCDS12336.1 [P78329-1]
PIRiS45702
RefSeqiNP_001073.3, NM_001082.4 [P78329-1]

3D structure databases

SMRiP78329
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114099, 37 interactors
IntActiP78329, 44 interactors
STRINGi9606.ENSP00000221700

Chemistry databases

BindingDBiP78329
ChEMBLiCHEMBL3379
DrugBankiDB14003, alpha-Tocopherol acetate
DB08868, Fingolimod
DB09148, Florbetaben (18F)
DB01026, Ketoconazole
DB09568, Omega-3-carboxylic acids
DB11635, Tocofersolan
DB11251, Tocopherol
GuidetoPHARMACOLOGYi1344
SwissLipidsiSLP:000000421

PTM databases

iPTMnetiP78329
PhosphoSitePlusiP78329

Genetic variation databases

BioMutaiCYP4F2
DMDMi6166044

Proteomic databases

jPOSTiP78329
MassIVEiP78329
MaxQBiP78329
PaxDbiP78329
PeptideAtlasiP78329
PRIDEiP78329
ProteomicsDBi5249
57568 [P78329-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2706, 147 antibodies

Genome annotation databases

EnsembliENST00000221700; ENSP00000221700; ENSG00000186115 [P78329-1]
GeneIDi8529
KEGGihsa:8529
UCSCiuc002nbs.2, human [P78329-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8529
DisGeNETi8529

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CYP4F2
HGNCiHGNC:2645, CYP4F2
HPAiENSG00000186115, Group enriched (intestine, liver)
MIMi122700, phenotype
604426, gene
neXtProtiNX_P78329
OpenTargetsiENSG00000186115
Orphaneti413674, Vitamin K antagonists toxicity or dose selection
PharmGKBiPA27121
VEuPathDBiHostDB:ENSG00000186115.12

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0157, Eukaryota
GeneTreeiENSGT00940000154646
HOGENOMiCLU_001570_5_1_1
InParanoidiP78329
OMAiECCTEMI
OrthoDBi1247045at2759
PhylomeDBiP78329
TreeFamiTF105088

Enzyme and pathway databases

UniPathwayiUPA00383
UPA00883
UPA01054
BioCyciMetaCyc:HS02675-MONOMER
BRENDAi1.14.13.30, 2681
PathwayCommonsiP78329
ReactomeiR-HSA-211935, Fatty acids
R-HSA-211958, Miscellaneous substrates
R-HSA-211979, Eicosanoids
R-HSA-2142691, Synthesis of Leukotrienes (LT) and Eoxins (EX)
R-HSA-2142816, Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE)

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
8529, 30 hits in 976 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CYP4F2, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CYP4F2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8529
PharosiP78329, Tchem

Protein Ontology

More...
PROi
PR:P78329
RNActiP78329, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186115, Expressed in caput epididymis and 113 other tissues
ExpressionAtlasiP78329, baseline and differential
GenevisibleiP78329, HS

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128, Cyt_P450
IPR017972, Cyt_P450_CS
IPR002401, Cyt_P450_E_grp-I
IPR036396, Cyt_P450_sf
PfamiView protein in Pfam
PF00067, p450, 1 hit
PRINTSiPR00463, EP450I
PR00385, P450
SUPFAMiSSF48264, SSF48264, 1 hit
PROSITEiView protein in PROSITE
PS00086, CYTOCHROME_P450, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCP4F2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78329
Secondary accession number(s): A0A024R7K3
, A8K425, B4DV75, Q16677, Q6NWT4, Q6NWT6, Q9NNZ0, Q9UIU8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: April 7, 2021
This is version 190 of the entry and version 1 of the sequence. See complete history.