Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (16 Oct 2019)
Sequence version 3 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nucleolar protein 14

Gene

NOP14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processRibosome biogenesis, rRNA processing

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6790901 rRNA modification in the nucleus and cytosol
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nucleolar protein 14
Alternative name(s):
Nucleolar complex protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NOP14
Synonyms:C4orf9, NOL14
ORF Names:RES4-25
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16821 NOP14

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611526 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78316

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
8602

Open Targets

More...
OpenTargetsi
ENSG00000087269

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164723982

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P78316

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NOP14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
56404449

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001371551 – 857Nucleolar protein 14Add BLAST857

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei96PhosphoserineCombined sources1
Modified residuei146PhosphoserineCombined sources1
Modified residuei148PhosphoserineCombined sources1
Modified residuei349PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P78316

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78316

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P78316

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P78316

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78316

PeptideAtlas

More...
PeptideAtlasi
P78316

PRoteomics IDEntifications database

More...
PRIDEi
P78316

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
57560 [P78316-1]
57561 [P78316-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P78316

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78316

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P78316

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P78316

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000087269 Expressed in 201 organ(s), highest expression level in oviduct epithelium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P78316 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78316 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039596
HPA055652

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the ribosomal small subunit (SSU) processome.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114162, 48 interactors

Protein interaction database and analysis system

More...
IntActi
P78316, 28 interactors

Molecular INTeraction database

More...
MINTi
P78316

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000405068

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P78316

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NOP14 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2147 Eukaryota
ENOG410XNWY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017459

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000285983

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78316

KEGG Orthology (KO)

More...
KOi
K14766

Identification of Orthologs from Complete Genome Data

More...
OMAi
DKHYDPD

Database of Orthologous Groups

More...
OrthoDBi
950459at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78316

TreeFam database of animal gene trees

More...
TreeFami
TF105698

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007276 Nop14

The PANTHER Classification System

More...
PANTHERi
PTHR23183 PTHR23183, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04147 Nop14, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P78316-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKAKKVGAR RKASGAPAGA RGGPAKANSN PFEVKVNRQK FQILGRKTRH
60 70 80 90 100
DVGLPGVSRA RALRKRTQTL LKEYKERDKS NVFRDKRFGE YNSNMSPEEK
110 120 130 140 150
MMKRFALEQQ RHHEKKSIYN LNEDEELTHY GQSLADIEKH NDIVDSDSDA
160 170 180 190 200
EDRGTLSAEL TAAHFGGGGG LLHKKTQQEG EEREKPKSRK ELIEELIAKS
210 220 230 240 250
KQEKRERQAQ REDALELTEK LDQDWKEIQT LLSHKTPKSE NRDKKEKPKP
260 270 280 290 300
DAYDMMVREL GFEMKAQPSN RMKTEAELAK EEQEHLRKLE AERLRRMLGK
310 320 330 340 350
DEDENVKKPK HMSADDLNDG FVLDKDDRRL LSYKDGKMNV EEDVQEEQSK
360 370 380 390 400
EASDPESNEE EGDSSGGEDT EESDSPDSHL DLESNVESEE ENEKPAKEQR
410 420 430 440 450
QTPGKGLISG KERAGKATRD ELPYTFAAPE SYEELRSLLL GRSMEEQLLV
460 470 480 490 500
VERIQKCNHP SLAEGNKAKL EKLFGFLLEY VGDLATDDPP DLTVIDKLVV
510 520 530 540 550
HLYHLCQMFP ESASDAIKFV LRDAMHEMEE MIETKGRAAL PGLDVLIYLK
560 570 580 590 600
ITGLLFPTSD FWHPVVTPAL VCLSQLLTKC PILSLQDVVK GLFVCCLFLE
610 620 630 640 650
YVALSQRFIP ELINFLLGIL YIATPNKASQ GSTLVHPFRA LGKNSELLVV
660 670 680 690 700
SAREDVATWQ QSSLSLRWAS RLRAPTSTEA NHIRLSCLAV GLALLKRCVL
710 720 730 740 750
MYGSLPSFHA IMGPLQALLT DHLADCSHPQ ELQELCQSTL TEMESQKQLC
760 770 780 790 800
RPLTCEKSKP VPLKLFTPRL VKVLEFGRKQ GSSKEEQERK RLIHKHKREF
810 820 830 840 850
KGAVREIRKD NQFLARMQLS EIMERDAERK RKVKQLFNSL ATQEGEWKAL

KRKKFKK
Length:857
Mass (Da):97,668
Last modified:December 7, 2004 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCDADFB91083DBB75
GO
Isoform 2 (identifier: P78316-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     772-819: KVLEFGRKQG...DNQFLARMQL → SNSRPQVIHLPWPPNYRCEPQHPAKKVIFFRVIML
     820-857: Missing.

Note: No experimental confirmation available.
Show »
Length:806
Mass (Da):91,385
Checksum:iB7EEF5F61E6D6390
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PFK5E9PFK5_HUMAN
Nucleolar protein 14
NOP14
788Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB97011 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053540380L → S1 PublicationCorresponds to variant dbSNP:rs2515960Ensembl.1
Natural variantiVAR_060075716Q → R. Corresponds to variant dbSNP:rs1054090Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018021772 – 819KVLEF…ARMQL → SNSRPQVIHLPWPPNYRCEP QHPAKKVIFFRVIML in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_018022820 – 857Missing in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF040965 mRNA Translation: AAB97011.1 Different initiation.
CH471131 Genomic DNA Translation: EAW82489.1
CH471131 Genomic DNA Translation: EAW82491.1
CH471131 Genomic DNA Translation: EAW82492.1
BC026035 mRNA Translation: AAH26035.1
BC053635 mRNA Translation: AAH53635.1
AB000467 mRNA Translation: BAA19121.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33945.1 [P78316-1]
CCDS77893.1 [P78316-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
JE0188

NCBI Reference Sequences

More...
RefSeqi
NP_001278907.1, NM_001291978.1 [P78316-1]
NP_001278908.1, NM_001291979.1 [P78316-2]
NP_003694.1, NM_003703.2 [P78316-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000314262; ENSP00000315674; ENSG00000087269 [P78316-1]
ENST00000398071; ENSP00000381146; ENSG00000087269 [P78316-2]
ENST00000416614; ENSP00000405068; ENSG00000087269 [P78316-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
8602

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:8602

UCSC genome browser

More...
UCSCi
uc003ggj.2 human [P78316-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040965 mRNA Translation: AAB97011.1 Different initiation.
CH471131 Genomic DNA Translation: EAW82489.1
CH471131 Genomic DNA Translation: EAW82491.1
CH471131 Genomic DNA Translation: EAW82492.1
BC026035 mRNA Translation: AAH26035.1
BC053635 mRNA Translation: AAH53635.1
AB000467 mRNA Translation: BAA19121.1
CCDSiCCDS33945.1 [P78316-1]
CCDS77893.1 [P78316-2]
PIRiJE0188
RefSeqiNP_001278907.1, NM_001291978.1 [P78316-1]
NP_001278908.1, NM_001291979.1 [P78316-2]
NP_003694.1, NM_003703.2 [P78316-1]

3D structure databases

SMRiP78316
ModBaseiSearch...

Protein-protein interaction databases

BioGridi114162, 48 interactors
IntActiP78316, 28 interactors
MINTiP78316
STRINGi9606.ENSP00000405068

PTM databases

iPTMnetiP78316
PhosphoSitePlusiP78316
SwissPalmiP78316

Polymorphism and mutation databases

BioMutaiNOP14
DMDMi56404449

Proteomic databases

EPDiP78316
jPOSTiP78316
MassIVEiP78316
MaxQBiP78316
PaxDbiP78316
PeptideAtlasiP78316
PRIDEiP78316
ProteomicsDBi57560 [P78316-1]
57561 [P78316-2]

Genome annotation databases

EnsembliENST00000314262; ENSP00000315674; ENSG00000087269 [P78316-1]
ENST00000398071; ENSP00000381146; ENSG00000087269 [P78316-2]
ENST00000416614; ENSP00000405068; ENSG00000087269 [P78316-1]
GeneIDi8602
KEGGihsa:8602
UCSCiuc003ggj.2 human [P78316-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8602
DisGeNETi8602

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NOP14
HGNCiHGNC:16821 NOP14
HPAiHPA039596
HPA055652
MIMi611526 gene
neXtProtiNX_P78316
OpenTargetsiENSG00000087269
PharmGKBiPA164723982

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2147 Eukaryota
ENOG410XNWY LUCA
GeneTreeiENSGT00390000017459
HOGENOMiHOG000285983
InParanoidiP78316
KOiK14766
OMAiDKHYDPD
OrthoDBi950459at2759
PhylomeDBiP78316
TreeFamiTF105698

Enzyme and pathway databases

ReactomeiR-HSA-6790901 rRNA modification in the nucleus and cytosol
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NOP14 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
8602
PharosiP78316
PMAP-CutDBiP78316

Protein Ontology

More...
PROi
PR:P78316

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000087269 Expressed in 201 organ(s), highest expression level in oviduct epithelium
ExpressionAtlasiP78316 baseline and differential
GenevisibleiP78316 HS

Family and domain databases

InterProiView protein in InterPro
IPR007276 Nop14
PANTHERiPTHR23183 PTHR23183, 1 hit
PfamiView protein in Pfam
PF04147 Nop14, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOP14_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78316
Secondary accession number(s): D3DVR6
, Q7LGI5, Q7Z6K0, Q8TBR6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: October 16, 2019
This is version 156 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again