Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nucleolar protein 14

Gene

NOP14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm (By similarity).By similarity

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • RNA binding Source: UniProtKB
  • snoRNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processRibosome biogenesis, rRNA processing

Enzyme and pathway databases

ReactomeiR-HSA-6790901 rRNA modification in the nucleus and cytosol
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleolar protein 14
Alternative name(s):
Nucleolar complex protein 14
Gene namesi
Name:NOP14
Synonyms:C4orf9, NOL14
ORF Names:RES4-25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000087269.15
HGNCiHGNC:16821 NOP14
MIMi611526 gene
neXtProtiNX_P78316

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8602
OpenTargetsiENSG00000087269
PharmGKBiPA164723982

Polymorphism and mutation databases

BioMutaiNOP14
DMDMi56404449

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001371551 – 857Nucleolar protein 14Add BLAST857

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei96PhosphoserineCombined sources1
Modified residuei146PhosphoserineCombined sources1
Modified residuei148PhosphoserineCombined sources1
Modified residuei349PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP78316
MaxQBiP78316
PaxDbiP78316
PeptideAtlasiP78316
PRIDEiP78316
ProteomicsDBi57560
57561 [P78316-2]

PTM databases

iPTMnetiP78316
PhosphoSitePlusiP78316

Miscellaneous databases

PMAP-CutDBiP78316

Expressioni

Gene expression databases

BgeeiENSG00000087269 Expressed in 201 organ(s), highest expression level in oviduct epithelium
CleanExiHS_NOP14
ExpressionAtlasiP78316 baseline and differential
GenevisibleiP78316 HS

Organism-specific databases

HPAiHPA039596
HPA055652

Interactioni

Subunit structurei

Component of the ribosomal small subunit (SSU) processome.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114162, 37 interactors
IntActiP78316, 13 interactors
MINTiP78316
STRINGi9606.ENSP00000315674

Structurei

3D structure databases

ProteinModelPortaliP78316
SMRiP78316
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NOP14 family.Curated

Phylogenomic databases

eggNOGiKOG2147 Eukaryota
ENOG410XNWY LUCA
GeneTreeiENSGT00390000017459
HOGENOMiHOG000285983
HOVERGENiHBG052649
InParanoidiP78316
KOiK14766
OMAiDKHYDPD
OrthoDBiEOG091G0DK0
PhylomeDBiP78316
TreeFamiTF105698

Family and domain databases

InterProiView protein in InterPro
IPR007276 Nop14
PANTHERiPTHR23183 PTHR23183, 1 hit
PfamiView protein in Pfam
PF04147 Nop14, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P78316-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKAKKVGAR RKASGAPAGA RGGPAKANSN PFEVKVNRQK FQILGRKTRH
60 70 80 90 100
DVGLPGVSRA RALRKRTQTL LKEYKERDKS NVFRDKRFGE YNSNMSPEEK
110 120 130 140 150
MMKRFALEQQ RHHEKKSIYN LNEDEELTHY GQSLADIEKH NDIVDSDSDA
160 170 180 190 200
EDRGTLSAEL TAAHFGGGGG LLHKKTQQEG EEREKPKSRK ELIEELIAKS
210 220 230 240 250
KQEKRERQAQ REDALELTEK LDQDWKEIQT LLSHKTPKSE NRDKKEKPKP
260 270 280 290 300
DAYDMMVREL GFEMKAQPSN RMKTEAELAK EEQEHLRKLE AERLRRMLGK
310 320 330 340 350
DEDENVKKPK HMSADDLNDG FVLDKDDRRL LSYKDGKMNV EEDVQEEQSK
360 370 380 390 400
EASDPESNEE EGDSSGGEDT EESDSPDSHL DLESNVESEE ENEKPAKEQR
410 420 430 440 450
QTPGKGLISG KERAGKATRD ELPYTFAAPE SYEELRSLLL GRSMEEQLLV
460 470 480 490 500
VERIQKCNHP SLAEGNKAKL EKLFGFLLEY VGDLATDDPP DLTVIDKLVV
510 520 530 540 550
HLYHLCQMFP ESASDAIKFV LRDAMHEMEE MIETKGRAAL PGLDVLIYLK
560 570 580 590 600
ITGLLFPTSD FWHPVVTPAL VCLSQLLTKC PILSLQDVVK GLFVCCLFLE
610 620 630 640 650
YVALSQRFIP ELINFLLGIL YIATPNKASQ GSTLVHPFRA LGKNSELLVV
660 670 680 690 700
SAREDVATWQ QSSLSLRWAS RLRAPTSTEA NHIRLSCLAV GLALLKRCVL
710 720 730 740 750
MYGSLPSFHA IMGPLQALLT DHLADCSHPQ ELQELCQSTL TEMESQKQLC
760 770 780 790 800
RPLTCEKSKP VPLKLFTPRL VKVLEFGRKQ GSSKEEQERK RLIHKHKREF
810 820 830 840 850
KGAVREIRKD NQFLARMQLS EIMERDAERK RKVKQLFNSL ATQEGEWKAL

KRKKFKK
Length:857
Mass (Da):97,668
Last modified:December 7, 2004 - v3
Checksum:iCDADFB91083DBB75
GO
Isoform 2 (identifier: P78316-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     772-819: KVLEFGRKQG...DNQFLARMQL → SNSRPQVIHLPWPPNYRCEPQHPAKKVIFFRVIML
     820-857: Missing.

Note: No experimental confirmation available.
Show »
Length:806
Mass (Da):91,385
Checksum:iB7EEF5F61E6D6390
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PFK5E9PFK5_HUMAN
Nucleolar protein 14
NOP14
788Annotation score:

Sequence cautioni

The sequence AAB97011 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053540380L → S1 PublicationCorresponds to variant dbSNP:rs2515960Ensembl.1
Natural variantiVAR_060075716Q → R. Corresponds to variant dbSNP:rs1054090Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018021772 – 819KVLEF…ARMQL → SNSRPQVIHLPWPPNYRCEP QHPAKKVIFFRVIML in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_018022820 – 857Missing in isoform 2. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040965 mRNA Translation: AAB97011.1 Different initiation.
CH471131 Genomic DNA Translation: EAW82489.1
CH471131 Genomic DNA Translation: EAW82491.1
CH471131 Genomic DNA Translation: EAW82492.1
BC026035 mRNA Translation: AAH26035.1
BC053635 mRNA Translation: AAH53635.1
AB000467 mRNA Translation: BAA19121.1
CCDSiCCDS33945.1 [P78316-1]
CCDS77893.1 [P78316-2]
PIRiJE0188
RefSeqiNP_001278907.1, NM_001291978.1 [P78316-1]
NP_001278908.1, NM_001291979.1 [P78316-2]
NP_003694.1, NM_003703.2 [P78316-1]
UniGeneiHs.627133

Genome annotation databases

EnsembliENST00000314262; ENSP00000315674; ENSG00000087269 [P78316-1]
ENST00000398071; ENSP00000381146; ENSG00000087269 [P78316-2]
ENST00000416614; ENSP00000405068; ENSG00000087269 [P78316-1]
GeneIDi8602
KEGGihsa:8602
UCSCiuc003ggj.2 human [P78316-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040965 mRNA Translation: AAB97011.1 Different initiation.
CH471131 Genomic DNA Translation: EAW82489.1
CH471131 Genomic DNA Translation: EAW82491.1
CH471131 Genomic DNA Translation: EAW82492.1
BC026035 mRNA Translation: AAH26035.1
BC053635 mRNA Translation: AAH53635.1
AB000467 mRNA Translation: BAA19121.1
CCDSiCCDS33945.1 [P78316-1]
CCDS77893.1 [P78316-2]
PIRiJE0188
RefSeqiNP_001278907.1, NM_001291978.1 [P78316-1]
NP_001278908.1, NM_001291979.1 [P78316-2]
NP_003694.1, NM_003703.2 [P78316-1]
UniGeneiHs.627133

3D structure databases

ProteinModelPortaliP78316
SMRiP78316
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114162, 37 interactors
IntActiP78316, 13 interactors
MINTiP78316
STRINGi9606.ENSP00000315674

PTM databases

iPTMnetiP78316
PhosphoSitePlusiP78316

Polymorphism and mutation databases

BioMutaiNOP14
DMDMi56404449

Proteomic databases

EPDiP78316
MaxQBiP78316
PaxDbiP78316
PeptideAtlasiP78316
PRIDEiP78316
ProteomicsDBi57560
57561 [P78316-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314262; ENSP00000315674; ENSG00000087269 [P78316-1]
ENST00000398071; ENSP00000381146; ENSG00000087269 [P78316-2]
ENST00000416614; ENSP00000405068; ENSG00000087269 [P78316-1]
GeneIDi8602
KEGGihsa:8602
UCSCiuc003ggj.2 human [P78316-1]

Organism-specific databases

CTDi8602
DisGeNETi8602
EuPathDBiHostDB:ENSG00000087269.15
GeneCardsiNOP14
H-InvDBiHIX0004040
HGNCiHGNC:16821 NOP14
HPAiHPA039596
HPA055652
MIMi611526 gene
neXtProtiNX_P78316
OpenTargetsiENSG00000087269
PharmGKBiPA164723982
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2147 Eukaryota
ENOG410XNWY LUCA
GeneTreeiENSGT00390000017459
HOGENOMiHOG000285983
HOVERGENiHBG052649
InParanoidiP78316
KOiK14766
OMAiDKHYDPD
OrthoDBiEOG091G0DK0
PhylomeDBiP78316
TreeFamiTF105698

Enzyme and pathway databases

ReactomeiR-HSA-6790901 rRNA modification in the nucleus and cytosol
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Miscellaneous databases

GenomeRNAii8602
PMAP-CutDBiP78316
PROiPR:P78316
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000087269 Expressed in 201 organ(s), highest expression level in oviduct epithelium
CleanExiHS_NOP14
ExpressionAtlasiP78316 baseline and differential
GenevisibleiP78316 HS

Family and domain databases

InterProiView protein in InterPro
IPR007276 Nop14
PANTHERiPTHR23183 PTHR23183, 1 hit
PfamiView protein in Pfam
PF04147 Nop14, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNOP14_HUMAN
AccessioniPrimary (citable) accession number: P78316
Secondary accession number(s): D3DVR6
, Q7LGI5, Q7Z6K0, Q8TBR6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: November 7, 2018
This is version 147 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again