Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3 domain-binding protein 2

Gene

SH3BP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds differentially to the SH3 domains of certain proteins of signal transduction pathways. Binds to phosphatidylinositols; linking the hemopoietic tyrosine kinase fes to the cytoplasmic membrane in a phosphorylation dependent mechanism.

GO - Molecular functioni

  • phosphotyrosine residue binding Source: CAFA
  • SH3/SH2 adaptor activity Source: ProtInc
  • SH3 domain binding Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

SignaLinkiP78314
SIGNORiP78314

Names & Taxonomyi

Protein namesi
Recommended name:
SH3 domain-binding protein 2
Short name:
3BP-2
Gene namesi
Name:SH3BP2
Synonyms:3BP2
ORF Names:RES4-23
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000087266.15
HGNCiHGNC:10825 SH3BP2
MIMi602104 gene
neXtProtiNX_P78314

Pathology & Biotechi

Involvement in diseasei

Cherubism (CRBM)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant syndrome characterized by excessive bone degradation of the upper and lower jaws, which often begins around three years of age. It is followed by development of fibrous tissue masses, which causes a characteristic facial swelling.
See also OMIM:118400
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013257415R → P in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013258415R → Q in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013259418P → H in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013260418P → L in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013261418P → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013262420G → E in CRBM. 1 PublicationCorresponds to variant dbSNP:rs28938171EnsemblClinVar.1
Natural variantiVAR_013263420G → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs28938170EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi6452
GeneReviewsiSH3BP2
MalaCardsiSH3BP2
MIMi118400 phenotype
OpenTargetsiENSG00000087266
Orphaneti184 Cherubism
PharmGKBiPA35733

Polymorphism and mutation databases

BioMutaiSH3BP2
DMDMi3023207

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000643651 – 561SH3 domain-binding protein 2Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei174Phosphotyrosine; by SYKBy similarity1
Modified residuei183Phosphotyrosine; by SYKBy similarity1
Modified residuei278PhosphoserineCombined sources1
Modified residuei416PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei448Phosphotyrosine; by SYKBy similarity1

Post-translational modificationi

Phosphorylated. Phosphorylation at Tyr-448 may stimulate the activity of the LYN kinase (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP78314
MaxQBiP78314
PaxDbiP78314
PeptideAtlasiP78314
PRIDEiP78314
ProteomicsDBi57557
57558 [P78314-2]
57559 [P78314-3]

PTM databases

iPTMnetiP78314
PhosphoSitePlusiP78314

Expressioni

Tissue specificityi

Expressed in a variety of tissues including lung, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

BgeeiENSG00000087266 Expressed in 174 organ(s), highest expression level in blood
CleanExiHS_SH3BP2
ExpressionAtlasiP78314 baseline and differential
GenevisibleiP78314 HS

Organism-specific databases

HPAiHPA036790

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112350, 22 interactors
IntActiP78314, 25 interactors
MINTiP78314
STRINGi9606.ENSP00000422168

Structurei

Secondary structure

1561
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP78314
SMRiP78314
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78314

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 130PHPROSITE-ProRule annotationAdd BLAST105
Domaini457 – 555SH2PROSITE-ProRule annotationAdd BLAST99

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi201 – 210SH3-binding10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi205 – 212Poly-Pro8
Compositional biasi236 – 240Poly-Pro5

Keywords - Domaini

SH2 domain, SH3-binding

Phylogenomic databases

eggNOGiENOG410IGI1 Eukaryota
ENOG4111SD6 LUCA
GeneTreeiENSGT00390000002216
HOGENOMiHOG000190359
HOVERGENiHBG000016
InParanoidiP78314
KOiK07984
OMAiHHGSLCL
OrthoDBiEOG091G050K
PhylomeDBiP78314
TreeFamiTF333342

Family and domain databases

CDDicd10359 SH2_SH3BP2, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR035848 SH3BP2
IPR035847 SH3BP2_SH2
PANTHERiPTHR15126 PTHR15126, 1 hit
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50001 SH2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78314-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAEEMHWPV PMKAIGAQNL LTMPGGVAKA GYLHKKGGTQ LQLLKWPLRF
60 70 80 90 100
VIIHKRCVYY FKSSTSASPQ GAFSLSGYNR VMRAAEETTS NNVFPFKIIH
110 120 130 140 150
ISKKHRTWFF SASSEEERKS WMALLRREIG HFHEKKDLPL DTSDSSSDTD
160 170 180 190 200
SFYGAVERPV DISLSPYPTD NEDYEHDDED DSYLEPDSPE PGRLEDALMH
210 220 230 240 250
PPAYPPPPVP TPRKPAFSDM PRAHSFTSKG PGPLLPPPPP KHGLPDVGLA
260 270 280 290 300
AEDSKRDPLC PRRAEPCPRV PATPRRMSDP PLSTMPTAPG LRKPPCFRES
310 320 330 340 350
ASPSPEPWTP GHGACSTSSA AIMATATSRN CDKLKSFHLS PRGPPTSEPP
360 370 380 390 400
PVPANKPKFL KIAEEDPPRE AAMPGLFVPP VAPRPPALKL PVPEAMARPA
410 420 430 440 450
VLPRPEKPQL PHLQRSPPDG QSFRSFSFEK PRQPSQADTG GDDSDEDYEK
460 470 480 490 500
VPLPNSVFVN TTESCEVERL FKATSPRGEP QDGLYCIRNS STKSGKVLVV
510 520 530 540 550
WDETSNKVRN YRIFEKDSKF YLEGEVLFVS VGSMVEHYHT HVLPSHQSLL
560
LRHPYGYTGP R
Length:561
Mass (Da):62,244
Last modified:July 15, 1998 - v2
Checksum:i69E6846A4F6D8F15
GO
Isoform 2 (identifier: P78314-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     81-97: VMRAAEETTSNNVFPFK → QPRPQPAQALSQTEAGP
     98-561: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:97
Mass (Da):10,624
Checksum:i58CB0FBE9EB3A7FF
GO
Isoform 3 (identifier: P78314-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASLGPRTPAPSRSRGRRAMCWVSTISFM

Note: No experimental confirmation available.
Show »
Length:589
Mass (Da):65,305
Checksum:iB41A1B1688245A77
GO
Isoform 4 (identifier: P78314-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAGSGPRPRSWGRREAGARDEAAAAGGRGPGPCRCSQGRRAWIAPGKPAMPAAWTPFM

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):68,129
Checksum:i4A1A055BBB057AD9
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBL6D6RBL6_HUMAN
SH3 domain-binding protein 2
SH3BP2
194Annotation score:
D6RER9D6RER9_HUMAN
SH3 domain-binding protein 2
SH3BP2
188Annotation score:
D6R995D6R995_HUMAN
SH3 domain-binding protein 2
SH3BP2
172Annotation score:
D6RC64D6RC64_HUMAN
SH3 domain-binding protein 2
SH3BP2
136Annotation score:
D6RAB4D6RAB4_HUMAN
SH3 domain-binding protein 2
SH3BP2
142Annotation score:
H0YAD9H0YAD9_HUMAN
SH3 domain-binding protein 2
SH3BP2
190Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27V → L in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti224H → N in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti249L → R in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti251A → P in AAB59973 (PubMed:9734812).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013257415R → P in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013258415R → Q in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013259418P → H in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013260418P → L in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013261418P → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013262420G → E in CRBM. 1 PublicationCorresponds to variant dbSNP:rs28938171EnsemblClinVar.1
Natural variantiVAR_013263420G → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs28938170EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0436361M → MASLGPRTPAPSRSRGRRAM CWVSTISFM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0550461M → MAGSGPRPRSWGRREAGARD EAAAAGGRGPGPCRCSQGRR AWIAPGKPAMPAAWTPFM in isoform 4. Curated1
Alternative sequenceiVSP_00408581 – 97VMRAA…VFPFK → QPRPQPAQALSQTEAGP in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_00408698 – 561Missing in isoform 2. 2 PublicationsAdd BLAST464

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000936 mRNA Translation: AAB59973.1
U56386 mRNA Translation: AAB72034.1
AB000462 mRNA Translation: BAA19119.1
AB000463 mRNA Translation: BAA19120.1
AK299996 mRNA Translation: BAG61816.1
AK312286 mRNA Translation: BAG35213.1
AL121750 Genomic DNA No translation available.
CH471131 Genomic DNA Translation: EAW82509.1
CH471131 Genomic DNA Translation: EAW82510.1
CH471131 Genomic DNA Translation: EAW82511.1
CH471131 Genomic DNA Translation: EAW82512.1
BC022996 mRNA Translation: AAH22996.1
CCDSiCCDS33944.1 [P78314-1]
CCDS54715.1 [P78314-3]
CCDS54716.1 [P78314-4]
RefSeqiNP_001116153.1, NM_001122681.1 [P78314-1]
NP_001139327.1, NM_001145855.1 [P78314-3]
NP_001139328.1, NM_001145856.1 [P78314-4]
NP_003014.3, NM_003023.4 [P78314-1]
UniGeneiHs.167679

Genome annotation databases

EnsembliENST00000356331; ENSP00000348685; ENSG00000087266 [P78314-1]
ENST00000435136; ENSP00000403231; ENSG00000087266 [P78314-1]
ENST00000442312; ENSP00000388152; ENSG00000087266 [P78314-3]
ENST00000452765; ENSP00000409746; ENSG00000087266 [P78314-1]
ENST00000503393; ENSP00000422168; ENSG00000087266 [P78314-4]
ENST00000511747; ENSP00000424846; ENSG00000087266 [P78314-1]
ENST00000513020; ENSP00000424072; ENSG00000087266 [P78314-2]
ENST00000515737; ENSP00000422605; ENSG00000087266 [P78314-2]
GeneIDi6452
KEGGihsa:6452
UCSCiuc003gfi.5 human [P78314-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000936 mRNA Translation: AAB59973.1
U56386 mRNA Translation: AAB72034.1
AB000462 mRNA Translation: BAA19119.1
AB000463 mRNA Translation: BAA19120.1
AK299996 mRNA Translation: BAG61816.1
AK312286 mRNA Translation: BAG35213.1
AL121750 Genomic DNA No translation available.
CH471131 Genomic DNA Translation: EAW82509.1
CH471131 Genomic DNA Translation: EAW82510.1
CH471131 Genomic DNA Translation: EAW82511.1
CH471131 Genomic DNA Translation: EAW82512.1
BC022996 mRNA Translation: AAH22996.1
CCDSiCCDS33944.1 [P78314-1]
CCDS54715.1 [P78314-3]
CCDS54716.1 [P78314-4]
RefSeqiNP_001116153.1, NM_001122681.1 [P78314-1]
NP_001139327.1, NM_001145855.1 [P78314-3]
NP_001139328.1, NM_001145856.1 [P78314-4]
NP_003014.3, NM_003023.4 [P78314-1]
UniGeneiHs.167679

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CR4NMR-A446-558[»]
3TWRX-ray1.55E/F/G/H410-425[»]
ProteinModelPortaliP78314
SMRiP78314
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112350, 22 interactors
IntActiP78314, 25 interactors
MINTiP78314
STRINGi9606.ENSP00000422168

PTM databases

iPTMnetiP78314
PhosphoSitePlusiP78314

Polymorphism and mutation databases

BioMutaiSH3BP2
DMDMi3023207

Proteomic databases

EPDiP78314
MaxQBiP78314
PaxDbiP78314
PeptideAtlasiP78314
PRIDEiP78314
ProteomicsDBi57557
57558 [P78314-2]
57559 [P78314-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356331; ENSP00000348685; ENSG00000087266 [P78314-1]
ENST00000435136; ENSP00000403231; ENSG00000087266 [P78314-1]
ENST00000442312; ENSP00000388152; ENSG00000087266 [P78314-3]
ENST00000452765; ENSP00000409746; ENSG00000087266 [P78314-1]
ENST00000503393; ENSP00000422168; ENSG00000087266 [P78314-4]
ENST00000511747; ENSP00000424846; ENSG00000087266 [P78314-1]
ENST00000513020; ENSP00000424072; ENSG00000087266 [P78314-2]
ENST00000515737; ENSP00000422605; ENSG00000087266 [P78314-2]
GeneIDi6452
KEGGihsa:6452
UCSCiuc003gfi.5 human [P78314-1]

Organism-specific databases

CTDi6452
DisGeNETi6452
EuPathDBiHostDB:ENSG00000087266.15
GeneCardsiSH3BP2
GeneReviewsiSH3BP2
HGNCiHGNC:10825 SH3BP2
HPAiHPA036790
MalaCardsiSH3BP2
MIMi118400 phenotype
602104 gene
neXtProtiNX_P78314
OpenTargetsiENSG00000087266
Orphaneti184 Cherubism
PharmGKBiPA35733
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGI1 Eukaryota
ENOG4111SD6 LUCA
GeneTreeiENSGT00390000002216
HOGENOMiHOG000190359
HOVERGENiHBG000016
InParanoidiP78314
KOiK07984
OMAiHHGSLCL
OrthoDBiEOG091G050K
PhylomeDBiP78314
TreeFamiTF333342

Enzyme and pathway databases

SignaLinkiP78314
SIGNORiP78314

Miscellaneous databases

ChiTaRSiSH3BP2 human
EvolutionaryTraceiP78314
GenomeRNAii6452
PROiPR:P78314
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000087266 Expressed in 174 organ(s), highest expression level in blood
CleanExiHS_SH3BP2
ExpressionAtlasiP78314 baseline and differential
GenevisibleiP78314 HS

Family and domain databases

CDDicd10359 SH2_SH3BP2, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR035848 SH3BP2
IPR035847 SH3BP2_SH2
PANTHERiPTHR15126 PTHR15126, 1 hit
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50001 SH2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry namei3BP2_HUMAN
AccessioniPrimary (citable) accession number: P78314
Secondary accession number(s): A6NNC2
, B2R5R6, B4DT04, D3DVR0, D6R919, O00500, O15373, P78315
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 15, 1998
Last modified: November 7, 2018
This is version 173 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again