Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 185 (12 Aug 2020)
Sequence version 2 (15 Jul 1998)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

SH3 domain-binding protein 2

Gene

SH3BP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds differentially to the SH3 domains of certain proteins of signal transduction pathways. Binds to phosphatidylinositols; linking the hemopoietic tyrosine kinase fes to the cytoplasmic membrane in a phosphorylation dependent mechanism.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • signal transduction Source: ProtInc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P78314

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P78314

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P78314

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH3 domain-binding protein 2
Short name:
3BP-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH3BP2
Synonyms:3BP2
ORF Names:RES4-23
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000087266.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10825, SH3BP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602104, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P78314

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cherubism (CRBM)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant syndrome characterized by excessive bone degradation of the upper and lower jaws, which often begins around three years of age. It is followed by development of fibrous tissue masses, which causes a characteristic facial swelling.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_013257415R → P in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013258415R → Q in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013259418P → H in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013260418P → L in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013261418P → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013262420G → E in CRBM. 1 PublicationCorresponds to variant dbSNP:rs28938171EnsemblClinVar.1
Natural variantiVAR_013263420G → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs28938170EnsemblClinVar.1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
6452

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
SH3BP2

MalaCards human disease database

More...
MalaCardsi
SH3BP2
MIMi118400, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000087266

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
184, Cherubism

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35733

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P78314, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH3BP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
3023207

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000643651 – 561SH3 domain-binding protein 2Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei174Phosphotyrosine; by SYKBy similarity1
Modified residuei183Phosphotyrosine; by SYKBy similarity1
Modified residuei278PhosphoserineCombined sources1
Modified residuei416PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei448Phosphotyrosine; by SYKBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation at Tyr-448 may stimulate the activity of the LYN kinase (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P78314

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P78314

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P78314

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P78314

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P78314

PeptideAtlas

More...
PeptideAtlasi
P78314

PRoteomics IDEntifications database

More...
PRIDEi
P78314

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
12870
57557 [P78314-1]
57558 [P78314-2]
57559 [P78314-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P78314

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P78314

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a variety of tissues including lung, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000087266, Expressed in blood and 189 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P78314, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P78314, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000087266, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
112350, 23 interactors

Protein interaction database and analysis system

More...
IntActi
P78314, 26 interactors

Molecular INTeraction database

More...
MINTi
P78314

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000422168

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P78314, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1561
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P78314

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P78314

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini26 – 130PHPROSITE-ProRule annotationAdd BLAST105
Domaini457 – 555SH2PROSITE-ProRule annotationAdd BLAST99

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi201 – 210SH3-binding10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi205 – 212Poly-Pro8
Compositional biasi236 – 240Poly-Pro5

Keywords - Domaini

SH2 domain, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RF2Z, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002216

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_040124_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P78314

KEGG Orthology (KO)

More...
KOi
K07984

Identification of Orthologs from Complete Genome Data

More...
OMAi
AEETHWP

Database of Orthologous Groups

More...
OrthoDBi
1189650at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P78314

TreeFam database of animal gene trees

More...
TreeFami
TF333342

Family and domain databases

Conserved Domains Database

More...
CDDi
cd10359, SH2_SH3BP2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR035848, SH3BP2
IPR035847, SH3BP2_SH2

The PANTHER Classification System

More...
PANTHERi
PTHR15126, PTHR15126, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169, PH, 1 hit
PF00017, SH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233, PH, 1 hit
SM00252, SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55550, SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS50001, SH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P78314-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAEEMHWPV PMKAIGAQNL LTMPGGVAKA GYLHKKGGTQ LQLLKWPLRF
60 70 80 90 100
VIIHKRCVYY FKSSTSASPQ GAFSLSGYNR VMRAAEETTS NNVFPFKIIH
110 120 130 140 150
ISKKHRTWFF SASSEEERKS WMALLRREIG HFHEKKDLPL DTSDSSSDTD
160 170 180 190 200
SFYGAVERPV DISLSPYPTD NEDYEHDDED DSYLEPDSPE PGRLEDALMH
210 220 230 240 250
PPAYPPPPVP TPRKPAFSDM PRAHSFTSKG PGPLLPPPPP KHGLPDVGLA
260 270 280 290 300
AEDSKRDPLC PRRAEPCPRV PATPRRMSDP PLSTMPTAPG LRKPPCFRES
310 320 330 340 350
ASPSPEPWTP GHGACSTSSA AIMATATSRN CDKLKSFHLS PRGPPTSEPP
360 370 380 390 400
PVPANKPKFL KIAEEDPPRE AAMPGLFVPP VAPRPPALKL PVPEAMARPA
410 420 430 440 450
VLPRPEKPQL PHLQRSPPDG QSFRSFSFEK PRQPSQADTG GDDSDEDYEK
460 470 480 490 500
VPLPNSVFVN TTESCEVERL FKATSPRGEP QDGLYCIRNS STKSGKVLVV
510 520 530 540 550
WDETSNKVRN YRIFEKDSKF YLEGEVLFVS VGSMVEHYHT HVLPSHQSLL
560
LRHPYGYTGP R
Length:561
Mass (Da):62,244
Last modified:July 15, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i69E6846A4F6D8F15
GO
Isoform 2 (identifier: P78314-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     81-97: VMRAAEETTSNNVFPFK → QPRPQPAQALSQTEAGP
     98-561: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:97
Mass (Da):10,624
Checksum:i58CB0FBE9EB3A7FF
GO
Isoform 3 (identifier: P78314-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASLGPRTPAPSRSRGRRAMCWVSTISFM

Show »
Length:589
Mass (Da):65,305
Checksum:iB41A1B1688245A77
GO
Isoform 4 (identifier: P78314-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAGSGPRPRSWGRREAGARDEAAAAGGRGPGPCRCSQGRRAWIAPGKPAMPAAWTPFM

Show »
Length:618
Mass (Da):68,129
Checksum:i4A1A055BBB057AD9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RER9D6RER9_HUMAN
SH3 domain-binding protein 2
SH3BP2
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAD9H0YAD9_HUMAN
SH3 domain-binding protein 2
SH3BP2
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RBL6D6RBL6_HUMAN
SH3 domain-binding protein 2
SH3BP2
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R995D6R995_HUMAN
SH3 domain-binding protein 2
SH3BP2
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RC64D6RC64_HUMAN
SH3 domain-binding protein 2
SH3BP2
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAB4D6RAB4_HUMAN
SH3 domain-binding protein 2
SH3BP2
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A499FIV3A0A499FIV3_HUMAN
SH3 domain-binding protein 2
SH3BP2
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti27V → L in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti224H → N in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti249L → R in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti251A → P in AAB59973 (PubMed:9734812).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013257415R → P in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013258415R → Q in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909149EnsemblClinVar.1
Natural variantiVAR_013259418P → H in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013260418P → L in CRBM. 1 PublicationCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013261418P → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs121909146EnsemblClinVar.1
Natural variantiVAR_013262420G → E in CRBM. 1 PublicationCorresponds to variant dbSNP:rs28938171EnsemblClinVar.1
Natural variantiVAR_013263420G → R in CRBM. 2 PublicationsCorresponds to variant dbSNP:rs28938170EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0436361M → MASLGPRTPAPSRSRGRRAM CWVSTISFM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0550461M → MAGSGPRPRSWGRREAGARD EAAAAGGRGPGPCRCSQGRR AWIAPGKPAMPAAWTPFM in isoform 4. Curated1
Alternative sequenceiVSP_00408581 – 97VMRAA…VFPFK → QPRPQPAQALSQTEAGP in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_00408698 – 561Missing in isoform 2. 2 PublicationsAdd BLAST464

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF000936 mRNA Translation: AAB59973.1
U56386 mRNA Translation: AAB72034.1
AB000462 mRNA Translation: BAA19119.1
AB000463 mRNA Translation: BAA19120.1
AK299996 mRNA Translation: BAG61816.1
AK312286 mRNA Translation: BAG35213.1
AL121750 Genomic DNA No translation available.
CH471131 Genomic DNA Translation: EAW82509.1
CH471131 Genomic DNA Translation: EAW82510.1
CH471131 Genomic DNA Translation: EAW82511.1
CH471131 Genomic DNA Translation: EAW82512.1
BC022996 mRNA Translation: AAH22996.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33944.1 [P78314-1]
CCDS54715.1 [P78314-3]
CCDS54716.1 [P78314-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001116153.1, NM_001122681.1 [P78314-1]
NP_001139327.1, NM_001145855.1 [P78314-3]
NP_001139328.1, NM_001145856.1 [P78314-4]
NP_003014.3, NM_003023.4 [P78314-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356331; ENSP00000348685; ENSG00000087266 [P78314-1]
ENST00000435136; ENSP00000403231; ENSG00000087266 [P78314-3]
ENST00000503393; ENSP00000422168; ENSG00000087266 [P78314-1]
ENST00000511747; ENSP00000424846; ENSG00000087266 [P78314-4]
ENST00000513020; ENSP00000424072; ENSG00000087266 [P78314-2]
ENST00000515737; ENSP00000422605; ENSG00000087266 [P78314-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6452

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6452

UCSC genome browser

More...
UCSCi
uc003gfi.5, human [P78314-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000936 mRNA Translation: AAB59973.1
U56386 mRNA Translation: AAB72034.1
AB000462 mRNA Translation: BAA19119.1
AB000463 mRNA Translation: BAA19120.1
AK299996 mRNA Translation: BAG61816.1
AK312286 mRNA Translation: BAG35213.1
AL121750 Genomic DNA No translation available.
CH471131 Genomic DNA Translation: EAW82509.1
CH471131 Genomic DNA Translation: EAW82510.1
CH471131 Genomic DNA Translation: EAW82511.1
CH471131 Genomic DNA Translation: EAW82512.1
BC022996 mRNA Translation: AAH22996.1
CCDSiCCDS33944.1 [P78314-1]
CCDS54715.1 [P78314-3]
CCDS54716.1 [P78314-4]
RefSeqiNP_001116153.1, NM_001122681.1 [P78314-1]
NP_001139327.1, NM_001145855.1 [P78314-3]
NP_001139328.1, NM_001145856.1 [P78314-4]
NP_003014.3, NM_003023.4 [P78314-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CR4NMR-A446-558[»]
3TWRX-ray1.55E/F/G/H410-425[»]
SMRiP78314
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112350, 23 interactors
IntActiP78314, 26 interactors
MINTiP78314
STRINGi9606.ENSP00000422168

PTM databases

iPTMnetiP78314
PhosphoSitePlusiP78314

Polymorphism and mutation databases

BioMutaiSH3BP2
DMDMi3023207

Proteomic databases

EPDiP78314
jPOSTiP78314
MassIVEiP78314
MaxQBiP78314
PaxDbiP78314
PeptideAtlasiP78314
PRIDEiP78314
ProteomicsDBi12870
57557 [P78314-1]
57558 [P78314-2]
57559 [P78314-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
8898, 194 antibodies

Genome annotation databases

EnsembliENST00000356331; ENSP00000348685; ENSG00000087266 [P78314-1]
ENST00000435136; ENSP00000403231; ENSG00000087266 [P78314-3]
ENST00000503393; ENSP00000422168; ENSG00000087266 [P78314-1]
ENST00000511747; ENSP00000424846; ENSG00000087266 [P78314-4]
ENST00000513020; ENSP00000424072; ENSG00000087266 [P78314-2]
ENST00000515737; ENSP00000422605; ENSG00000087266 [P78314-2]
GeneIDi6452
KEGGihsa:6452
UCSCiuc003gfi.5, human [P78314-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6452
DisGeNETi6452
EuPathDBiHostDB:ENSG00000087266.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH3BP2
GeneReviewsiSH3BP2
HGNCiHGNC:10825, SH3BP2
HPAiENSG00000087266, Low tissue specificity
MalaCardsiSH3BP2
MIMi118400, phenotype
602104, gene
neXtProtiNX_P78314
OpenTargetsiENSG00000087266
Orphaneti184, Cherubism
PharmGKBiPA35733

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RF2Z, Eukaryota
GeneTreeiENSGT00390000002216
HOGENOMiCLU_040124_0_0_1
InParanoidiP78314
KOiK07984
OMAiAEETHWP
OrthoDBi1189650at2759
PhylomeDBiP78314
TreeFamiTF333342

Enzyme and pathway databases

PathwayCommonsiP78314
SignaLinkiP78314
SIGNORiP78314

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
6452, 12 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SH3BP2, human
EvolutionaryTraceiP78314

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6452
PharosiP78314, Tbio

Protein Ontology

More...
PROi
PR:P78314
RNActiP78314, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000087266, Expressed in blood and 189 other tissues
ExpressionAtlasiP78314, baseline and differential
GenevisibleiP78314, HS

Family and domain databases

CDDicd10359, SH2_SH3BP2, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR000980, SH2
IPR036860, SH2_dom_sf
IPR035848, SH3BP2
IPR035847, SH3BP2_SH2
PANTHERiPTHR15126, PTHR15126, 1 hit
PfamiView protein in Pfam
PF00169, PH, 1 hit
PF00017, SH2, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00252, SH2, 1 hit
SUPFAMiSSF55550, SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS50001, SH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei3BP2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78314
Secondary accession number(s): A6NNC2
, B2R5R6, B4DT04, D3DVR0, D6R919, O00500, O15373, P78315
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 15, 1998
Last modified: August 12, 2020
This is version 185 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again