Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P78310 (CXAR_HUMAN)

Entry version 200 (11 Dec 2019)
Sequence version 1 (01 May 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Coxsackievirus and adenovirus receptor

Gene

CXADR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the epithelial apical junction complex that may function as a homophilic cell adhesion molecule and is essential for tight junction integrity. Also involved in transepithelial migration of leukocytes through adhesive interactions with JAML a transmembrane protein of the plasma membrane of leukocytes. The interaction between both receptors also mediates the activation of gamma-delta T-cells, a subpopulation of T-cells residing in epithelia and involved in tissue homeostasis and repair. Upon epithelial CXADR-binding, JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases. It results in proliferation and production of cytokines and growth factors by T-cells that in turn stimulate epithelial tissues repair.5 Publications
(Microbial infection) Acts as a receptor for adenovirus type C.4 Publications
(Microbial infection) Acts as a receptor for Coxsackievirus B1 to B6.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHost cell receptor for virus entry, Receptor
Biological processCell adhesion, Host-virus interaction

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.23.1.14 the basigin (basigin) family

UniLectin database of carbohydrate-binding proteins

More...UniLectini		P78310

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coxsackievirus and adenovirus receptor
Short name:
CAR
Short name:
hCAR
Alternative name(s):
CVB3-binding protein
Coxsackievirus B-adenovirus receptor
HCVADR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CXADR
Synonyms:CAR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000154639.18

Human Gene Nomenclature Database

More...HGNCi		HGNC:2559 CXADR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602621 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P78310

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini20 – 237ExtracellularSequence analysisAdd BLAST218
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei238 – 258HelicalSequence analysisAdd BLAST21
Topological domaini259 – 365CytoplasmicSequence analysisAdd BLAST107

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Secreted, Tight junction

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi70 – 72VII → AID: Abolishes binding to adenovirus type 5. 1 Publication3
Mutagenesisi259 – 260CC → AA: Loss of palmitoylation and altered localization. 1 Publication2
Mutagenesisi318Y → A: Affects basolateral localization in airway epithelial cells. 1 Publication1
Mutagenesisi345 – 348LSRM → AAAA: Affects basolateral localization in airway epithelial cells. 1 Publication4

Organism-specific databases

DisGeNET

More...DisGeNETi		1525

Open Targets

More...OpenTargetsi		ENSG00000154639

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27055

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P78310 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CXADR

Domain mapping of disease mutations (DMDM)

More...DMDMi		6685351

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001473920 – 365Coxsackievirus and adenovirus receptorAdd BLAST346

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi41 ↔ 1203 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi106N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi162 ↔ 212PROSITE-ProRule annotation1 Publication
Glycosylationi201N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi259S-palmitoyl cysteine1 Publication1
Lipidationi260S-palmitoyl cysteine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei297PhosphoserineBy similarity1
Modified residuei304PhosphoserineBy similarity1
Modified residuei306PhosphoserineCombined sources1
Modified residuei323PhosphoserineCombined sources1
Modified residuei332PhosphoserineCombined sources1
Modified residuei363PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.By similarity
Palmitoylated on Cys-259 and/or Cys-260; required for proper localization to the plasma membrane.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P78310

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P78310

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P78310

MaxQB - The MaxQuant DataBase

More...MaxQBi		P78310

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P78310

PeptideAtlas

More...PeptideAtlasi		P78310

PRoteomics IDEntifications database

More...PRIDEi		P78310

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		12784
57548 [P78310-1]
57549 [P78310-2]
57550 [P78310-3]
57551 [P78310-4]
57552 [P78310-5]
6303

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1159

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P78310

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P78310

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P78310

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in pancreas, brain, heart, small intestine, testis, prostate and at a lower level in liver and lung. Isoform 5 is ubiquitously expressed. Isoform 3 is expressed in heart, lung and pancreas. In skeletal muscle, isoform 1 is found at the neuromuscular junction and isoform 2 is found in blood vessels. In cardiac muscle, isoform 1 and isoform 2 are found at intercalated disks. In heart expressed in subendothelial layers of the vessel wall but not in the luminal endothelial surface. Expression is elevated in hearts with dilated cardiomyopathy.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000154639 Expressed in 222 organ(s), highest expression level in neocortex

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P78310 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB005103
HPA003342
HPA030411
HPA030412

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer. May form homodimer.

Interacts with LNX, BAIAP1, DLG4, PRKCABP, TJP1 and CTNNB1.

Interacts with MPDZ; recruits MPDZ to intercellular contact sites.

Interacts with JAML (homodimeric form). Secreted isoform 3, isoform 4 and isoform 5 can interact with the extracellular domain of the receptor.

6 Publications

(Microbial infection) Interacts with adenovirus subgroups A, C, D, E and F fiber proteins as well as coxsackievirus B1, B2, B3, B4, B5 and B6 capsid proteins (PubMed:14978041, PubMed:9733828, PubMed:10666333, PubMed:10814575, PubMed:12297051, PubMed:10567268).

6 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		107905, 22 interactors

Protein interaction database and analysis system

More...IntActi		P78310, 13 interactors

Molecular INTeraction database

More...MINTi		P78310

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000284878

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P78310 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1365
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P78310

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P78310

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 134Ig-like C2-type 1Add BLAST115
Domaini141 – 228Ig-like C2-type 2Add BLAST88

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi360 – 365PDZ-binding6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Ig-like C2-type 1 domain mediates homodimerization and interaction with JAML.
The PDZ-binding motif mediates interaction with MPDZ and BAIAP1.

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IGDG Eukaryota
ENOG4110WP1 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154829

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000111222

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P78310

KEGG Orthology (KO)

More...KOi		K06788

Identification of Orthologs from Complete Genome Data

More...OMAi		PSNLHEY

Database of Orthologous Groups

More...OrthoDBi		896005at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P78310

TreeFam database of animal gene trees

More...TreeFami		TF330875

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR013151 Immunoglobulin

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00047 ig, 1 hit
PF07686 V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SM00406 IGv, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726 SSF48726, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835 IG_LIKE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P78310-1) [UniParc]FASTAAdd to basket
Also known as: SIV

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALLLCFVLL CGVVDFARSL SITTPEEMIE KAKGETAYLP CKFTLSPEDQ 
        60         70         80         90        100
GPLDIEWLIS PADNQKVDQV IILYSGDKIY DDYYPDLKGR VHFTSNDLKS 
       110        120        130        140        150
GDASINVTNL QLSDIGTYQC KVKKAPGVAN KKIHLVVLVK PSGARCYVDG 
       160        170        180        190        200
SEEIGSDFKI KCEPKEGSLP LQYEWQKLSD SQKMPTSWLA EMTSSVISVK 
       210        220        230        240        250
NASSEYSGTY SCTVRNRVGS DQCLLRLNVV PPSNKAGLIA GAIIGTLLAL 
       260        270        280        290        300
ALIGLIIFCC RKKRREEKYE KEVHHDIRED VPPPKSRTST ARSYIGSNHS 
       310        320        330        340        350
SLGSMSPSNM EGYSKTQYNQ VPSEDFERTP QSPTLPPAKV AAPNLSRMGA 
       360 
IPVMIPAQSK DGSIV
Length:365
Mass (Da):40,030
Last modified:May 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAB01C6346CB7FE64
GO
Isoform 2 (identifier: P78310-2) [UniParc]FASTAAdd to basket
Also known as: CAR2, HCAR2, TVV

The sequence of this isoform differs from the canonical sequence as follows:
     340-345: VAAPNL → FKYPY
     346-365: Missing.

Show »
Length:344
Mass (Da):38,124
Checksum:iEEE9C22E96C697AA
GO
Isoform 3 (identifier: P78310-3) [UniParc]FASTAAdd to basket
Also known as: CAR2/7, Gamma

The sequence of this isoform differs from the canonical sequence as follows:
     71-89: IILYSGDKIYDDYYPDLKG → GRCATSKEPYVHCQKLHRQ
     90-365: Missing.

Show »
Length:89
Mass (Da):9,967
Checksum:i50951EAAC77CAE36
GO
Isoform 4 (identifier: P78310-4) [UniParc]FASTAAdd to basket
Also known as: CAR3/7

The sequence of this isoform differs from the canonical sequence as follows:
     139-139: V → GKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLNALLRVRLSHLLR
     140-365: Missing.

Show »
Length:200
Mass (Da):22,370
Checksum:i43FDB19DF6A7FEB8
GO
Isoform 5 (identifier: P78310-5) [UniParc]FASTAAdd to basket
Also known as: CAR4/7, Beta

The sequence of this isoform differs from the canonical sequence as follows:
     191-191: E → GKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLNALLRVRLSHLLR
     192-365: Missing.

Show »
Length:252
Mass (Da):28,201
Checksum:i4532559D01AB67E2
GO
Isoform 6 (identifier: P78310-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     340-365: VAAPNLSRMGAIPVMIPAQSKDGSIV → FKYPYKTDGITVV

Show »
Length:352
Mass (Da):38,938
Checksum:i0D7C56FEBE6BD653
GO
Isoform 7 (identifier: P78310-7) [UniParc]FASTAAdd to basket
Also known as: CAR 4/6

The sequence of this isoform differs from the canonical sequence as follows:
     191-232: EMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPP → A

Show »
Length:324
Mass (Da):35,570
Checksum:i97915CFCAF43B698
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P78310-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti343P → A in AAD31772 (PubMed:10490761).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049871323S → R. Corresponds to variant dbSNP:rs34727960Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01481971 – 89IILYS…PDLKG → GRCATSKEPYVHCQKLHRQ in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01482090 – 365Missing in isoform 3. 1 PublicationAdd BLAST276
Alternative sequenceiVSP_014821139V → GKMCHLQRAVRPLPEATSAV IIHPWGPCLLPTWKDIPRLS ITKYQVKTLNALLRVRLSHL LR in isoform 4. 1 Publication1
Alternative sequenceiVSP_014822140 – 365Missing in isoform 4. 1 PublicationAdd BLAST226
Alternative sequenceiVSP_047729191 – 232EMTSS…NVVPP → A in isoform 7. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_014823191E → GKMCHLQRAVRPLPEATSAV IIHPWGPCLLPTWKDIPRLS ITKYQVKTLNALLRVRLSHL LR in isoform 5. 1 Publication1
Alternative sequenceiVSP_014824192 – 365Missing in isoform 5. 1 PublicationAdd BLAST174
Alternative sequenceiVSP_047357340 – 365VAAPN…DGSIV → FKYPYKTDGITVV in isoform 6. CuratedAdd BLAST26
Alternative sequenceiVSP_014825340 – 345VAAPNL → FKYPY in isoform 2. 1 Publication6
Alternative sequenceiVSP_014826346 – 365Missing in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U90716 mRNA Translation: AAC51234.1
Y07593 mRNA Translation: CAA68868.1
AF169366 AF169365 Genomic DNA Translation: AAF05908.1
AF200465 Genomic DNA Translation: AAF24344.1
AY072910 mRNA Translation: AAL68878.1
AY072911 mRNA Translation: AAL68879.1
AY072912 mRNA Translation: AAL68880.1
AF242865, AF242862, AF242864 Genomic DNA Translation: AAG01088.1
GU474812 mRNA Translation: ADC84500.1
CR617256 mRNA No translation available.
BT019876 mRNA Translation: AAV38679.1
AK313526 mRNA Translation: BAG36305.1
AP000963 Genomic DNA No translation available.
AP000967 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX10031.1
BC003684 mRNA Translation: AAH03684.1
BC010536 mRNA Translation: AAH10536.1
AF124598 mRNA Translation: AAD31772.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33519.1 [P78310-1]
CCDS56204.1 [P78310-6]
CCDS56205.1 [P78310-5]
CCDS56206.1 [P78310-4]
CCDS56207.1 [P78310-3]

NCBI Reference Sequences

More...RefSeqi		NP_001193992.1, NM_001207063.1 [P78310-5]
NP_001193993.1, NM_001207064.1 [P78310-4]
NP_001193994.1, NM_001207065.1 [P78310-3]
NP_001193995.1, NM_001207066.1 [P78310-6]
NP_001329.1, NM_001338.4 [P78310-1]
XP_011527781.1, XM_011529479.1 [P78310-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000284878; ENSP00000284878; ENSG00000154639 [P78310-1]
ENST00000356275; ENSP00000348620; ENSG00000154639 [P78310-3]
ENST00000400165; ENSP00000383029; ENSG00000154639 [P78310-4]
ENST00000400166; ENSP00000383030; ENSG00000154639 [P78310-5]
ENST00000400169; ENSP00000383033; ENSG00000154639 [P78310-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1525

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1525

UCSC genome browser

More...UCSCi		uc002ykh.3 human [P78310-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U90716 mRNA Translation: AAC51234.1
Y07593 mRNA Translation: CAA68868.1
AF169366 AF169365 Genomic DNA Translation: AAF05908.1
AF200465 Genomic DNA Translation: AAF24344.1
AY072910 mRNA Translation: AAL68878.1
AY072911 mRNA Translation: AAL68879.1
AY072912 mRNA Translation: AAL68880.1
AF242865, AF242862, AF242864 Genomic DNA Translation: AAG01088.1
GU474812 mRNA Translation: ADC84500.1
CR617256 mRNA No translation available.
BT019876 mRNA Translation: AAV38679.1
AK313526 mRNA Translation: BAG36305.1
AP000963 Genomic DNA No translation available.
AP000967 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX10031.1
BC003684 mRNA Translation: AAH03684.1
BC010536 mRNA Translation: AAH10536.1
AF124598 mRNA Translation: AAD31772.1
CCDSiCCDS33519.1 [P78310-1]
CCDS56204.1 [P78310-6]
CCDS56205.1 [P78310-5]
CCDS56206.1 [P78310-4]
CCDS56207.1 [P78310-3]
RefSeqiNP_001193992.1, NM_001207063.1 [P78310-5]
NP_001193993.1, NM_001207064.1 [P78310-4]
NP_001193994.1, NM_001207065.1 [P78310-3]
NP_001193995.1, NM_001207066.1 [P78310-6]
NP_001329.1, NM_001338.4 [P78310-1]
XP_011527781.1, XM_011529479.1 [P78310-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1EAJX-ray1.35A/B15-140[»]
1F5WX-ray1.70A/B15-140[»]
1JEWelectron microscopy22.00R21-140[»]
1KACX-ray2.60B22-144[»]
1P69X-ray3.10B22-144[»]
1P6AX-ray2.90B22-144[»]
1RSFNMR-A21-144[»]
2J12X-ray1.50B15-140[»]
2J1KX-ray2.30A/B/G/J/K/O/P/T/V/X/Y/Z15-140[»]
2NPLNMR-X142-235[»]
2W9LX-ray2.91A/B/G/J/K/O/P/T/V/X/Y/Z16-139[»]
2WBWX-ray1.55B15-138[»]
3J6Lelectron microscopy9.00B15-140[»]
3J6Melectron microscopy9.00B22-144[»]
3J6Nelectron microscopy9.00K20-233[»]
3J6Oelectron microscopy9.00S20-236[»]
SMRiP78310
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi107905, 22 interactors
IntActiP78310, 13 interactors
MINTiP78310
STRINGi9606.ENSP00000284878

Protein family/group databases

TCDBi8.A.23.1.14 the basigin (basigin) family
UniLectiniP78310

PTM databases

GlyConnecti1159
iPTMnetiP78310
PhosphoSitePlusiP78310
SwissPalmiP78310

Polymorphism and mutation databases

BioMutaiCXADR
DMDMi6685351

Proteomic databases

EPDiP78310
jPOSTiP78310
MassIVEiP78310
MaxQBiP78310
PaxDbiP78310
PeptideAtlasiP78310
PRIDEiP78310
ProteomicsDBi12784
57548 [P78310-1]
57549 [P78310-2]
57550 [P78310-3]
57551 [P78310-4]
57552 [P78310-5]
6303

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		1525

Genome annotation databases

EnsembliENST00000284878; ENSP00000284878; ENSG00000154639 [P78310-1]
ENST00000356275; ENSP00000348620; ENSG00000154639 [P78310-3]
ENST00000400165; ENSP00000383029; ENSG00000154639 [P78310-4]
ENST00000400166; ENSP00000383030; ENSG00000154639 [P78310-5]
ENST00000400169; ENSP00000383033; ENSG00000154639 [P78310-6]
GeneIDi1525
KEGGihsa:1525
UCSCiuc002ykh.3 human [P78310-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1525
DisGeNETi1525
EuPathDBiHostDB:ENSG00000154639.18

GeneCards: human genes, protein and diseases

More...GeneCardsi		CXADR
HGNCiHGNC:2559 CXADR
HPAiCAB005103
HPA003342
HPA030411
HPA030412
MIMi602621 gene
neXtProtiNX_P78310
OpenTargetsiENSG00000154639
PharmGKBiPA27055

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IGDG Eukaryota
ENOG4110WP1 LUCA
GeneTreeiENSGT00940000154829
HOGENOMiHOG000111222
InParanoidiP78310
KOiK06788
OMAiPSNLHEY
OrthoDBi896005at2759
PhylomeDBiP78310
TreeFamiTF330875

Enzyme and pathway databases

ReactomeiR-HSA-198933 Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
R-HSA-202733 Cell surface interactions at the vascular wall

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CXADR human
EvolutionaryTraceiP78310

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Coxsackie_virus_and_adenovirus_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1525
PharosiP78310 Tbio

Protein Ontology

More...PROi		PR:P78310
RNActiP78310 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000154639 Expressed in 222 organ(s), highest expression level in neocortex
GenevisibleiP78310 HS

Family and domain databases

Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR013106 Ig_V-set
IPR013151 Immunoglobulin
PfamiView protein in Pfam
PF00047 ig, 1 hit
PF07686 V-set, 1 hit
SMARTiView protein in SMART
SM00409 IG, 2 hits
SM00408 IGc2, 2 hits
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 2 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCXAR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P78310
Secondary accession number(s): B2R8V8
, B7WPI3, D3YHP0, O00694, Q8WWT6, Q8WWT7, Q8WWT8, Q9UKV4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: May 1, 1997
Last modified: December 11, 2019
This is version 200 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again