Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 161 (07 Apr 2021)
Sequence version 3 (18 Oct 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Phospholipase D1

Gene

Pld1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Function as phospholipase selective for phosphatidylcholine (By similarity).

Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (By similarity).

By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42. Inhibited by oleate.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.4, 5301

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-1483166, Synthesis of PA
R-RNO-2029485, Role of phospholipids in phagocytosis
R-RNO-6798695, Neutrophil degranulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipase D1Curated (EC:3.1.4.4By similarity)
Short name:
PLD 1
Short name:
rPLD1
Alternative name(s):
Choline phosphatase 1
Phosphatidylcholine-hydrolyzing phospholipase D1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pld1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
3349, Pld1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi240C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-241. 1 Publication1
Mutagenesisi241C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-240. 1 Publication1

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3308939

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002188041 – 1074Phospholipase D1Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi240S-palmitoyl cysteine1 Publication1
Lipidationi241S-palmitoyl cysteine1 Publication1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei499PhosphoserineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei629PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine and threonine residues.1 Publication
It is uncertain whether palmitoylation is on Cys-240 and/or Cys-241. Palmitoylation is required prior to phosphorylation.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P70496

PeptideAtlas

More...
PeptideAtlasi
P70496

PRoteomics IDEntifications database

More...
PRIDEi
P70496

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P70496

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P70496

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P70496

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PIP5K1B.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
247168, 1 interactor

Protein interaction database and analysis system

More...
IntActi
P70496, 1 interactor

Molecular INTeraction database

More...
MINTi
P70496

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000034466

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P70496

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 212PXPROSITE-ProRule annotationAdd BLAST132
Domaini219 – 328PHPROSITE-ProRule annotationAdd BLAST110
Domaini459 – 486PLD phosphodiesterase 1PROSITE-ProRule annotationAdd BLAST28
Domaini891 – 918PLD phosphodiesterase 2PROSITE-ProRule annotationAdd BLAST28

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni463 – 928CatalyticAdd BLAST466

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the phospholipase D family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1329, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P70496

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P70496

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.30.1520.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR025202, PLD-like_dom
IPR001736, PLipase_D/transphosphatidylase
IPR016555, PLipase_D_euk
IPR015679, PLipase_D_fam
IPR001683, PX_dom
IPR036871, PX_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR18896, PTHR18896, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169, PH, 1 hit
PF00614, PLDc, 1 hit
PF13091, PLDc_2, 1 hit
PF00787, PX, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF009376, Phospholipase_D_euk, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233, PH, 1 hit
SM00155, PLDc, 2 hits
SM00312, PX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF64268, SSF64268, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS50035, PLD, 2 hits
PS50195, PX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform PLD1A (identifier: P70496-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLRSEARVN TSTLQKIAAD MSNLIENLDT RELHFEGEEV EYDASPGDPT
60 70 80 90 100
AQEACIPFSS IYNTQGFKEP NIQIYLSGCP VKAQVLEVER FTSTSRMPSV
110 120 130 140 150
NLYTIELTHG EFTWQVKRKF KHFQEFHREL LKYKAFIRIP IPTKRHTFRR
160 170 180 190 200
QNVKEEPREM PSLPRSSENA IQEEQFFGRR KQLEDYLTKI LKMPMYRNYH
210 220 230 240 250
ATTEFLDVSQ LSFIHDLGPK GLEGMIMKRS GGHRIPGVNC CGHGRACYRW
260 270 280 290 300
SKRWLIVKDS FLLYMKPDSG AIAFVLLVDK EFRIKVGKKE TETKYGLRID
310 320 330 340 350
NLSRTLILKC NSYRHARWWG GAIEEFIQKH GTDFLKDHRF GSYAAVHENI
360 370 380 390 400
LAKWYVNAKG YFEDIANAME GATEEIFITD WWLSPEIFLK RPVVEGNRWR
410 420 430 440 450
LDCILKRKAQ QGVRIFIMLY KEVELALGIN SEYTKRTLMR LHPNIKVMRH
460 470 480 490 500
PDHVSSSVYL WAHHEKLVII DQSVAFVGGI DLAYGRWDDN EHRLTDVGSV
510 520 530 540 550
KRVTSGQSLG SLTAASVESM ESLSLKDKHQ SHKNEPVLKS VNDTDMKLKG
560 570 580 590 600
IGKSRKFSKF SLYRQLHRRN LHNSDSISSV DSASSYFNHY RSHQNLIHGI
610 620 630 640 650
KPHLKLFRPS SESEQGLTRH SADTGSIRSV QTGVGELHGE TRFWHGKDYC
660 670 680 690 700
NFVFKDWVQL DKPFADFIDR YSTPRMPWHD IGSVVHGKAA RDVARHFIQR
710 720 730 740 750
WNFTKIMKPK YRSLSYPFLL PKSQATAHEL RYQVPGAVHA KAQLLRSAAD
760 770 780 790 800
WSAGIKHHEE SIHAAYTHVI ENSKHYIYIE NQFFISCADD KVVFNKVGNA
810 820 830 840 850
IAQRILKAHR EGQRYRVYIV IPLLPGFEGD ISTGGGNALQ AIMHFNYRTM
860 870 880 890 900
CRGESSILEQ LKPELGNKWI NYISFCGLRT HAELEGNLVT ELIYVHSKLL
910 920 930 940 950
IADDNTVIIG SANINDRSML GKRDSEMAVI VQDTETVPSV MDGKEYQAGR
960 970 980 990 1000
FAQGLRLECF RLVLGYLSDP SEDIQDPVSD KFFKEIWVST AARNATIYDK
1010 1020 1030 1040 1050
VFRCLPNDEV HNLIQLRDFI NKPILAKEDR LRAEEELRKI RGFLVQFPFY
1060 1070
FLSEENLLPS VGTKEAIVPM EVWT
Length:1,074
Mass (Da):123,814
Last modified:October 18, 2001 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i286943A447A881DB
GO
Isoform PLD1B (identifier: P70496-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-623: SYFNHYRSHQNLIHGIKPHLKLFRPSSESEQGLTRHSAD → N

Show »
Length:1,036
Mass (Da):119,357
Checksum:i350956C43A38E506
GO
Isoform PLD1C (identifier: P70496-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-590: YFNHY → ESRLR
     591-1074: Missing.

Show »
Length:590
Mass (Da):68,318
Checksum:iFBD1FD4D7FAF9D18
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2K5R0A0A0G2K5R0_RAT
Phospholipase
Pld1
1,077Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F1LMG4F1LMG4_RAT
Phospholipase
Pld1
1,074Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D4A318D4A318_RAT
Phospholipase
Pld1
1,036Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4R → K in BAA24576 (PubMed:9445394).Curated1
Sequence conflicti22S → R (PubMed:9361006).Curated1
Sequence conflicti22S → R (Ref. 6) Curated1
Sequence conflicti283R → K in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti283R → K in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti542N → D (PubMed:9533024).Curated1
Sequence conflicti542N → D (PubMed:8753790).Curated1
Sequence conflicti542N → D (PubMed:9445394).Curated1
Sequence conflicti600I → L in BAA24576 (PubMed:9445394).Curated1
Sequence conflicti709P → A in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti709P → A in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti735 – 736PG → EV in BAA24076 (PubMed:9533024).Curated2
Sequence conflicti735 – 736PG → EV in BAA24077 (PubMed:9533024).Curated2
Sequence conflicti739 – 740HA → QP in BAA24076 (PubMed:9533024).Curated2
Sequence conflicti739 – 740HA → QP in BAA24077 (PubMed:9533024).Curated2
Sequence conflicti773S → T (PubMed:9533024).Curated1
Sequence conflicti775H → R (PubMed:9533024).Curated1
Sequence conflicti786S → T in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti786S → T in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti800A → C in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti800A → C in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti809H → T in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti809H → T in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti830D → N in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti830D → N in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti934 – 935TE → RQ in AAB86910 (PubMed:9361006).Curated2
Sequence conflicti951 – 954FAQG → SLSTV (PubMed:9533024).Curated4

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005024585 – 623SYFNH…RHSAD → N in isoform PLD1B. 4 PublicationsAdd BLAST39
Alternative sequenceiVSP_005025586 – 590YFNHY → ESRLR in isoform PLD1C. 1 Publication5
Alternative sequenceiVSP_005026591 – 1074Missing in isoform PLD1C. 1 PublicationAdd BLAST484

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB003170 mRNA Translation: BAA24076.1
AB003171 mRNA Translation: BAA24077.1
U69550 mRNA Translation: AAB86910.1
AB000778 mRNA Translation: BAA24576.1
AB000779 mRNA Translation: BAA24577.1
U88986 mRNA Translation: AAB91329.1
AF017251 mRNA Translation: AAD01609.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T13725
T13732
T13943
T46635

NCBI Reference Sequences

More...
RefSeqi
NP_112254.1, NM_030992.1

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25096

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:25096

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003170 mRNA Translation: BAA24076.1
AB003171 mRNA Translation: BAA24077.1
U69550 mRNA Translation: AAB86910.1
AB000778 mRNA Translation: BAA24576.1
AB000779 mRNA Translation: BAA24577.1
U88986 mRNA Translation: AAB91329.1
AF017251 mRNA Translation: AAD01609.1
PIRiT13725
T13732
T13943
T46635
RefSeqiNP_112254.1, NM_030992.1

3D structure databases

SMRiP70496
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi247168, 1 interactor
IntActiP70496, 1 interactor
MINTiP70496
STRINGi10116.ENSRNOP00000034466

Chemistry databases

ChEMBLiCHEMBL3308939

PTM databases

iPTMnetiP70496
PhosphoSitePlusiP70496
SwissPalmiP70496

Proteomic databases

PaxDbiP70496
PeptideAtlasiP70496
PRIDEiP70496

Genome annotation databases

GeneIDi25096
KEGGirno:25096

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5337
RGDi3349, Pld1

Phylogenomic databases

eggNOGiKOG1329, Eukaryota
InParanoidiP70496
PhylomeDBiP70496

Enzyme and pathway databases

BRENDAi3.1.4.4, 5301
ReactomeiR-RNO-1483166, Synthesis of PA
R-RNO-2029485, Role of phospholipids in phagocytosis
R-RNO-6798695, Neutrophil degranulation

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P70496

Family and domain databases

Gene3Di2.30.29.30, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR025202, PLD-like_dom
IPR001736, PLipase_D/transphosphatidylase
IPR016555, PLipase_D_euk
IPR015679, PLipase_D_fam
IPR001683, PX_dom
IPR036871, PX_dom_sf
PANTHERiPTHR18896, PTHR18896, 1 hit
PfamiView protein in Pfam
PF00169, PH, 1 hit
PF00614, PLDc, 1 hit
PF13091, PLDc_2, 1 hit
PF00787, PX, 1 hit
PIRSFiPIRSF009376, Phospholipase_D_euk, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00155, PLDc, 2 hits
SM00312, PX, 1 hit
SUPFAMiSSF64268, SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50003, PH_DOMAIN, 1 hit
PS50035, PLD, 2 hits
PS50195, PX, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLD1_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P70496
Secondary accession number(s): O08959
, O35856, O54765, P70497, Q9QWJ6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: April 7, 2021
This is version 161 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again