Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (12 Aug 2020)
Sequence version 2 (03 Oct 2012)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Fibroblast growth factor 13

Gene

Fgf13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules (PubMed:22726441). Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching (PubMed:22726441). Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus (PubMed:22726441). May regulate voltage-gated sodium channels transport and function (PubMed:21817159). May also play a role in MAPK signaling (PubMed:11378392, PubMed:12244047). Required for the development of axonal initial segment-targeting inhibitory GABAergic synapses made by chandelier neurons (PubMed:30679375).5 Publications
seems not to be involved in neuroblast polarization and migration but regulates axon branching.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processNeurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-5576892, Phase 0 - rapid depolarisation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fibroblast growth factor 13
Short name:
FGF-13
Alternative name(s):
Fibroblast growth factor homologous factor 2
Short name:
FHF-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fgf13
Synonyms:Fhf2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:109178, Fgf13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Conditional knockout mice lacking fgf13 in the cerebral cortex or mice lacking fgf13 in most tissues display similar phenotypes of impaired spatial acquisition and memory. The cued memory and the capacity of novel object recognition are altered. They also display anxiety-related and reduced depression-like behaviors. This is associated with a disorganization of cortical structure and neural circuits. The laminar formation of the neocortex is delayed and the hippocampal development is also affected.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001476081 – 245Fibroblast growth factor 13Add BLAST245

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei208PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

May be phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P70377

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P70377

PeptideAtlas

More...
PeptideAtlasi
P70377

PRoteomics IDEntifications database

More...
PRIDEi
P70377

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P70377-2 [P70377-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P70377

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P70377

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in brain, eye and heart. In brain, the different isoforms display different patterns of expression. Expressed in brain and heart (at protein level). Isoform 3 is highly expressed in cardiac myocytes while isoform 1 is the most abundant in brain.3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the subplate of the embryonic cortex and the axonal tracts in the intermediate zone, and in axonal tracts of projection neurons, specifically in the corticothalamic tract and the corpus callosum (at protein level). Isoform 2 is transiently expressed in the neocortex and hippocampus from 17 dpc to P7 (at protein level). In embryonic brain, present in all divisions of the central and peripheral nervous system and it is at least 5 times more abundant than other FHFs. Detected in the subplate, ganglionic eminences, and proliferative zones of the cortical wall at 14 dpc. Detected in the cortical plate of the cerebral cortex, hippocampus, and striatum from 17 dpc to P14. Expression is markedly reduced in adult brain where it is most abundant in hippocampus. Also detected in developing kidney. Expressed in developing chandelier neurons.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000031137, Expressed in dorsal root ganglion and 305 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P70377, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P70377, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SCN8A; may regulate SCN8A activity (By similarity).

Interacts with SCN1A; may regulate SCN1A activity (By similarity).

Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function.

Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity.

By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
199642, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000033473

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P70377, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P70377

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 62Mediates targeting to the nucleusAdd BLAST62
Regioni67 – 201Mediates interaction with sodium channelsBy similarityAdd BLAST135
Regioni157 – 164Tubulin-binding domain necessary and sufficient for tubulin-binding8

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3885, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162313

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P70377

KEGG Orthology (KO)

More...
KOi
K22413

Identification of Orthologs from Complete Genome Data

More...
OMAi
MTFPLRK

Database of Orthologous Groups

More...
OrthoDBi
1192273at2759

TreeFam database of animal gene trees

More...
TreeFami
TF317805

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00058, FGF, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028279, FGF13
IPR002209, Fibroblast_GF_fam
IPR008996, IL1/FGF

The PANTHER Classification System

More...
PANTHERi
PTHR11486, PTHR11486, 1 hit
PTHR11486:SF77, PTHR11486:SF77, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00167, FGF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00263, HBGFFGF

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00442, FGF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50353, SSF50353, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00247, HBGF_FGF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P70377-1) [UniParc]FASTAAdd to basket
Also known as: FGF13A, mFHF-2(1S), FGF13-S

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAIASSLI RQKRQARERE KSNACKCVSS PSKGKTSCDK NKLNVFSRVK
60 70 80 90 100
LFGSKKRRRR RPEPQLKGIV TKLYSRQGYH LQLQADGTID GTKDEDSTYT
110 120 130 140 150
LFNLIPVGLR VVAIQGVQTK LYLAMNSEGY LYTSEHFTPE CKFKESVFEN
160 170 180 190 200
YYVTYSSMIY RQQQSGRGWY LGLNKEGEIM KGNHVKKNKP AAHFLPKPLK
210 220 230 240
VAMYKEPSLH DLTEFSRSGS GTPTKSRSVS GVLNGGKSMS HNEST
Length:245
Mass (Da):27,588
Last modified:October 3, 2012 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5B96D41AC3A3DF78
GO
Isoform 2 (identifier: P70377-2) [UniParc]FASTAAdd to basket
Also known as: FGF13B, mFHF-2(1U), FGF13-U

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS

Show »
Length:192
Mass (Da):21,605
Checksum:i7736A3671677B263
GO
Isoform 3 (identifier: P70377-3) [UniParc]FASTAAdd to basket
Also known as: FGF13-VY, mFHF-2(1Y+1V)

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MAAAIASSLI...SKKRRRRRPE → MSGKVTKPKE...HHKENTEPEE

Show »
Length:255
Mass (Da):28,760
Checksum:iE0EAE1C9DFFBE0EA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AU20B1AU20_MOUSE
Fibroblast growth factor
Fgf13
187Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A067XG51A0A067XG51_MOUSE
Fibroblast growth factor 13
Fgf13
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AU22B1AU22_MOUSE
Fibroblast growth factor 13
Fgf13
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B1AU23B1AU23_MOUSE
Fibroblast growth factor 13
Fgf13
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2A → T in AAB18918 (PubMed:8790420).Curated1
Sequence conflicti2Missing in AAB71606 (PubMed:9232594).Curated1
Sequence conflicti199L → Q in AAB71606 (PubMed:9232594).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0441301 – 63MAAAI…RRRPE → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPP KQVHHKENTEPEE in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0441311 – 62MAAAI…RRRRP → MALLRKSYS in isoform 2. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U66202 mRNA Translation: AAB18918.1
AF020737 mRNA Translation: AAB71606.1
AK141848 mRNA Translation: BAE24857.1
AL669891 Genomic DNA No translation available.
AL672247 Genomic DNA No translation available.
AL713968 Genomic DNA No translation available.
CH466583 Genomic DNA Translation: EDL42180.1
CH466583 Genomic DNA Translation: EDL42182.1
BC018238 mRNA Translation: AAH18238.1
AF199608 mRNA Translation: AAF31395.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30157.1 [P70377-1]
CCDS72383.1 [P70377-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001277344.1, NM_001290415.1 [P70377-2]
NP_034330.2, NM_010200.3 [P70377-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000033473; ENSMUSP00000033473; ENSMUSG00000031137 [P70377-1]
ENSMUST00000119306; ENSMUSP00000113206; ENSMUSG00000031137 [P70377-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
14168

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:14168

UCSC genome browser

More...
UCSCi
uc009tht.3, mouse [P70377-1]
uc009thu.3, mouse [P70377-2]
uc009thv.2, mouse [P70377-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66202 mRNA Translation: AAB18918.1
AF020737 mRNA Translation: AAB71606.1
AK141848 mRNA Translation: BAE24857.1
AL669891 Genomic DNA No translation available.
AL672247 Genomic DNA No translation available.
AL713968 Genomic DNA No translation available.
CH466583 Genomic DNA Translation: EDL42180.1
CH466583 Genomic DNA Translation: EDL42182.1
BC018238 mRNA Translation: AAH18238.1
AF199608 mRNA Translation: AAF31395.1
CCDSiCCDS30157.1 [P70377-1]
CCDS72383.1 [P70377-2]
RefSeqiNP_001277344.1, NM_001290415.1 [P70377-2]
NP_034330.2, NM_010200.3 [P70377-1]

3D structure databases

SMRiP70377
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi199642, 2 interactors
STRINGi10090.ENSMUSP00000033473

PTM databases

iPTMnetiP70377
PhosphoSitePlusiP70377

Proteomic databases

EPDiP70377
PaxDbiP70377
PeptideAtlasiP70377
PRIDEiP70377
TopDownProteomicsiP70377-2 [P70377-2]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
P70377, 2 sequenced antibodies

Genome annotation databases

EnsembliENSMUST00000033473; ENSMUSP00000033473; ENSMUSG00000031137 [P70377-1]
ENSMUST00000119306; ENSMUSP00000113206; ENSMUSG00000031137 [P70377-2]
GeneIDi14168
KEGGimmu:14168
UCSCiuc009tht.3, mouse [P70377-1]
uc009thu.3, mouse [P70377-2]
uc009thv.2, mouse [P70377-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2258
MGIiMGI:109178, Fgf13

Phylogenomic databases

eggNOGiKOG3885, Eukaryota
GeneTreeiENSGT00940000162313
InParanoidiP70377
KOiK22413
OMAiMTFPLRK
OrthoDBi1192273at2759
TreeFamiTF317805

Enzyme and pathway databases

ReactomeiR-MMU-5576892, Phase 0 - rapid depolarisation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
14168, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fgf13, mouse

Protein Ontology

More...
PROi
PR:P70377
RNActiP70377, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000031137, Expressed in dorsal root ganglion and 305 other tissues
ExpressionAtlasiP70377, baseline and differential
GenevisibleiP70377, MM

Family and domain databases

CDDicd00058, FGF, 1 hit
InterProiView protein in InterPro
IPR028279, FGF13
IPR002209, Fibroblast_GF_fam
IPR008996, IL1/FGF
PANTHERiPTHR11486, PTHR11486, 1 hit
PTHR11486:SF77, PTHR11486:SF77, 1 hit
PfamiView protein in Pfam
PF00167, FGF, 1 hit
PRINTSiPR00263, HBGFFGF
SMARTiView protein in SMART
SM00442, FGF, 1 hit
SUPFAMiSSF50353, SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247, HBGF_FGF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFGF13_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P70377
Secondary accession number(s): B1AU21
, O35338, Q3UR31, Q8VCY9, Q9JLA5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 3, 2012
Last modified: August 12, 2020
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again