Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P70365 (NCOA1_MOUSE)

Entry version 202 (25 May 2022)
Sequence version 2 (11 Oct 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear receptor coactivator 1

Gene

Ncoa1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3.

4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Acyltransferase, Transferase
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-159418, Recycling of bile acids and salts
R-MMU-192105, Synthesis of bile acids and bile salts
R-MMU-193368, Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
R-MMU-193807, Synthesis of bile acids and bile salts via 27-hydroxycholesterol
R-MMU-211976, Endogenous sterols
R-MMU-3214847, HATs acetylate histones
R-MMU-3899300, SUMOylation of transcription cofactors
R-MMU-400206, Regulation of lipid metabolism by PPARalpha
R-MMU-9018519, Estrogen-dependent gene expression
R-MMU-9029569, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
R-MMU-9623433, NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis
R-MMU-9707564, Cytoprotection by HMOX1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor coactivator 1 (EC:2.3.1.48)
Short name:
NCoA-1
Alternative name(s):
Nuclear receptor coactivator protein 1
Short name:
mNRC-1
Steroid receptor coactivator 1
Short name:
SRC-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ncoa1
Synonyms:Src1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:1276523, Ncoa1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000020647

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice show partial hormone resistance: target organs such as uterus, prostate, testis and mammary gland exhibiting decreased growth and development in response to steroid hormones. Moreover, such mice are prone to obesity due to reduced energy expenditure.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi695 – 698HRLL → AAAA: Abolishes the interactions with estrogen and retinoid-acids receptors. 1 Publication4
Mutagenesisi756 – 759RYLL → AAAA: Abolishes the interactions with estrogen and retinoid-acids receptors. 1 Publication4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000944012 – 1447Nuclear receptor coactivator 1Add BLAST1446

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineBy similarity1
Modified residuei22PhosphoserineCombined sources1
Modified residuei372PhosphoserineCombined sources1
Modified residuei395PhosphoserineBy similarity1
Modified residuei518PhosphoserineBy similarity1
Modified residuei559PhosphoserineCombined sources1
Modified residuei570PhosphoserineBy similarity1
Modified residuei702PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki738Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
Cross-linki780Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)By similarity
Cross-linki852Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1039PhosphoserineBy similarity1
Modified residuei1079Asymmetric dimethylarginineCombined sources1
Modified residuei1097Asymmetric dimethylarginineCombined sources1
Modified residuei1130Asymmetric dimethylarginineCombined sources1
Modified residuei1137Asymmetric dimethylarginineCombined sources1
Modified residuei1185PhosphothreonineBy similarity1
Modified residuei1191PhosphoserineBy similarity1
Modified residuei1378PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated; sumoylation increases its interaction with PGR and prolongs its retention in the nucleus. It does not prevent its ubiquitination and does not exert a clear effect on the stability of the protein (By similarity).By similarity
Ubiquitinated; leading to proteasome-mediated degradation. Ubiquitination and sumoylation take place at different sites (By similarity).By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P70365

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P70365

MaxQB - The MaxQuant DataBase

More...MaxQBi		P70365

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P70365

PeptideAtlas

More...PeptideAtlasi		P70365

PRoteomics IDEntifications database

More...PRIDEi		P70365

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		293632 [P70365-1]
293633 [P70365-2]
293634 [P70365-3]
293635 [P70365-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P70365

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P70365

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000020647, Expressed in rostral migratory stream and 325 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P70365, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P70365, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NCOA6 and NCOA2.

Interacts with the FDL motif of STAT5A and STAT5B.

Interacts with the LXXLL motif of STAT6.

Interacts with STAT3 following IL-6 stimulation.

Interacts with the basal transcription factor GTF2B.

Interacts with COPS5, NR3C1, PCAF and TTLL5/STAMP.

Interacts with the histone acetyltransferases EP300 and CREBBP, and the methyltransferase CARM1.

Interacts with PSMB9.

Interacts with UBE2L3; they functionally interact to regulate progesterone receptor transcriptional activity.

Interacts with PRMT2 and DDX5.

Interacts with ASXL1.

Interacts with PRMT6.

Interacts (via LXXLL 1, 2 and 3 motifs) with RORC (via AF-2 motif).

Interacts in a ligand-dependent fashion with RXRA.

Interacts with TRIP4.

Interacts with NR4A3 (PubMed:12709428).

Interacts with VDR (By similarity).

By similarity6 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		201707, 14 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-5343, RXRalpha-NCOA1 activated retinoic acid receptor complex
CPX-644, PXR-NCOA1 activated nuclear receptor complex
CPX-667, RARalpha-NCOA1 activated retinoic acid receptor complex
CPX-864, PPARgamma-NCOA1 activated nuclear receptor complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P70365

Protein interaction database and analysis system

More...IntActi		P70365, 3 interactors

Molecular INTeraction database

More...MINTi		P70365

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000082971

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P70365, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11447
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P70365

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P70365

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P70365

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 80bHLHPROSITE-ProRule annotationAdd BLAST58
Domaini109 – 180PASPROSITE-ProRule annotationAdd BLAST72

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 39DisorderedSequence analysisAdd BLAST39
Regioni83 – 105DisorderedSequence analysisAdd BLAST23
Regioni361 – 568Interaction with STAT3Add BLAST208
Regioni368 – 446DisorderedSequence analysisAdd BLAST79
Regioni459 – 478DisorderedSequence analysisAdd BLAST20
Regioni548 – 632DisorderedSequence analysisAdd BLAST85
Regioni663 – 688DisorderedSequence analysisAdd BLAST26
Regioni700 – 735DisorderedSequence analysisAdd BLAST36
Regioni787 – 994Interaction with CREBBP1 PublicationAdd BLAST208
Regioni1166 – 1195DisorderedSequence analysisAdd BLAST30
Regioni1268 – 1287DisorderedSequence analysisAdd BLAST20
Regioni1415 – 1447DisorderedSequence analysisAdd BLAST33

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi46 – 50LXXLL motif 15
Motifi112 – 116LXXLL motif 25
Motifi637 – 641LXXLL motif 35
Motifi694 – 698LXXLL motif 45
Motifi755 – 759LXXLL motif 55
Motifi919 – 923LXXLL motif 65
Motifi1441 – 1445LXXLL motif 75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi373 – 446Polar residuesSequence analysisAdd BLAST74
Compositional biasi548 – 579Polar residuesSequence analysisAdd BLAST32
Compositional biasi592 – 609Polar residuesSequence analysisAdd BLAST18
Compositional biasi663 – 687Polar residuesSequence analysisAdd BLAST25
Compositional biasi721 – 735Polar residuesSequence analysisAdd BLAST15
Compositional biasi1169 – 1183Pro residuesSequence analysisAdd BLAST15
Compositional biasi1420 – 1447Polar residuesSequence analysisAdd BLAST28

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal (1113-1447) part mediates the histone acetyltransferase (HAT) activity.By similarity
Contains 7 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. LXXLL motifs 3, 4 and 5 are essential for the association with nuclear receptors. LXXLL motif 7, which is not present in isoform 2, increases the affinity for steroid receptors in vitro.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SRC/p160 nuclear receptor coactivator family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3561, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183021

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_001988_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P70365

Identification of Orthologs from Complete Genome Data

More...OMAi		GVQGQFN

Database of Orthologous Groups

More...OrthoDBi		59971at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P70365

TreeFam database of animal gene trees

More...TreeFami		TF332652

Family and domain databases

Conserved Domains Database

More...CDDi		cd00130, PAS, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		4.10.280.10, 1 hit
6.10.140.410, 1 hit

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID50084

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011598, bHLH_dom
IPR036638, HLH_DNA-bd_sf
IPR010011, NCO_DUF1518
IPR028819, NCOA1
IPR009110, Nuc_rcpt_coact
IPR014920, Nuc_rcpt_coact_Ncoa-typ
IPR037077, Nuc_rcpt_coact_Ncoa_int_sf
IPR017426, Nuclear_rcpt_coactivator
IPR000014, PAS
IPR035965, PAS-like_dom_sf
IPR013767, PAS_fold
IPR014935, SRC/p160_LXXLL

The PANTHER Classification System

More...PANTHERi		PTHR10684, PTHR10684, 1 hit
PTHR10684:SF1, PTHR10684:SF1, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07469, DUF1518, 2 hits
PF00010, HLH, 1 hit
PF08815, Nuc_rec_co-act, 1 hit
PF00989, PAS, 1 hit
PF08832, SRC-1, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF038181, Nuclear_receptor_coactivator, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01151, DUF1518, 2 hits
SM00353, HLH, 1 hit
SM00091, PAS, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47459, SSF47459, 1 hit
SSF55785, SSF55785, 2 hits
SSF69125, SSF69125, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50888, BHLH, 1 hit
PS50112, PAS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P70365-1) [UniParc]FASTAAdd to basket
Also known as: SRC-1A, SRC1a

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGLGDSSSD PANPDSHKRK GSPCDTLASS TEKRRREQEN KYLEELAELL 
        60         70         80         90        100
SANISDIDSL SVKPDKCKIL KKTVDQIQLM KRMEQEKSTT DDDVQKSDIS 
       110        120        130        140        150
SSSQGVIEKE SLGPLLLEAL DGFFFVVNCE GRIVFVSENV TSYLGYNQEE 
       160        170        180        190        200
LMNTSVYSIL HVGDHAEFVK NLLPKSLVNG VPWPQEATRR NSHTFNCRML 
       210        220        230        240        250
IHPPEDPGTE NQEACQRYEV MQCFTVSQPK SIQEDGEDFQ SCLICIARRL 
       260        270        280        290        300
PRPPAITGVE SFMTKQDTTG KIISIDTSSL RAAGRTGWED LVRKCIYAFF 
       310        320        330        340        350
QPQGREPSYA RQLFQEVMTR GTASSPSYRF ILNDGTMLSA HTKCKLCYPQ 
       360        370        380        390        400
SPDMQPFIMG IHIIDREHSG LSPQDDSNSG MSIPRINPSV NPGISPAHGV 
       410        420        430        440        450
TRSSTLPPSN NNMVSARVNR QQSSDLNSSS SHTNSSNNQG NFGCSPGNQI 
       460        470        480        490        500
VANVALNQGQ AGSQSSNPSL NLNNSPMEGT GIALSQFMSP RRQANSGLAT 
       510        520        530        540        550
RARMSNNSFP PNIPTLSSPV GITSGACNNN NRSYSNIPVT SLQGMNEGPN 
       560        570        580        590        600
NSVGFSAGSP VLRQMSSQNS PSRLSMQPAK AESKDSKEIA SILNEMIQSD 
       610        620        630        640        650
NSDNSANEGK PLDSGLLHNN DRLSEGDSKY SQTSHKLVQL LTTTAEQQLR 
       660        670        680        690        700
HADIDTSCKD VLSCTGTSSS ASSNPSGGTC PSSHSSLTER HKILHRLLQE 
       710        720        730        740        750
GSPSDITTLS VEPEKKDSVP ASTAVSVSGQ SQGSASIKLE LDAAKKKESK 
       760        770        780        790        800
DHQLLRYLLD KDEKDLRSTP NLCLDDVKVK VEKKEQMDPC NTNPTPMTKP 
       810        820        830        840        850
APEEVKLESQ SQFTADLDQF DQLLPTLEKA AQLPSLCETD RMDGAVTGVS 
       860        870        880        890        900
IKAEVLPASL QPTTARAAPR LSRLPELELE AIDNQFGQPG AGDQIPWANN 
       910        920        930        940        950
TLTTINQNKP EDQCISSQLD ELLCPPTTVE GRNDEKALLE QLVSFLSGKD 
       960        970        980        990       1000
ETELAELDRA LGIDKLVQGG GLDVLSERFP PQQATPPLMM EDRPTLYSQP 
      1010       1020       1030       1040       1050
YSSPSPTAGL SGPFQGMVRQ KPSLGAMPVQ VTPPRGTFSP NMGMQPRQTL 
      1060       1070       1080       1090       1100
NRPPAAPNQL RLQLQQRLQG QQQLMHQNRQ AILNQFAANA PVGMNMRSGM 
      1110       1120       1130       1140       1150
QQQITPQPPL NAQMLAQRQR ELYSQQHRQR QIIQQQRAML MRHQSFGNNI 
      1160       1170       1180       1190       1200
PPSSGLPVQM GTPRLPQGAP QQFPYPPNYG TNPGTPPAST SPFSQLAANP 
      1210       1220       1230       1240       1250
EASLATRSSM VNRGMAGNMG GQFGAGISPQ MQQNVFQYPG PGLVPQGEAT 
      1260       1270       1280       1290       1300
FAPSLSPGSS MVPMPVPPPQ SSLLQQTPPT SGYQSPDMKA WQQGTMGNNN 
      1310       1320       1330       1340       1350
VFSQAVQSQP APAQPGVYNN MSITVSMAGG NANIQNMNPM MGQMQMSSLQ 
      1360       1370       1380       1390       1400
MPGMNTVCSE QMNDPALRHT GLYCNQLSST DLLKTDADGN QQVQQVQVFA 
      1410       1420       1430       1440 
DVQCTVNLVG GDPYLNQPGP LGTQKPTSGP QTPQAQQKSL LQQLLTE
Length:1,447
Mass (Da):157,016
Last modified:October 11, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65C08AFFCF14241D
GO
Isoform 2 (identifier: P70365-2) [UniParc]FASTAAdd to basket
Also known as: SRC-1E, SRC1e

The sequence of this isoform differs from the canonical sequence as follows:
     1392-1447: QVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE → DKKTEEFFSVVTTD

Show »
Length:1,405
Mass (Da):152,644
Checksum:i92088DAE1A6A7F77
GO
Isoform 3 (identifier: P70365-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1392-1447: QVQQVQVFAD...KSLLQQLLTE → VSKKDNPSAELADSITLDTWRTSHGIC

Show »
Length:1,418
Mass (Da):153,943
Checksum:i2AE9E75D49E5D1DC
GO
Isoform 4 (identifier: P70365-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1300-1376: NVFSQAVQSQ...LRHTGLYCNQ → KWKRKHSEHESNDGPDANELSADARDEYCVL
     1377-1447: Missing.

Show »
Length:1,330
Mass (Da):144,762
Checksum:iD7787C36638B2D94
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2P7C1A0A1W2P7C1_MOUSE
Nuclear receptor coactivator 1
Ncoa1
922Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7S6A0A1W2P7S6_MOUSE
Nuclear receptor coactivator 1
Ncoa1
430Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7D7A0A1W2P7D7_MOUSE
Nuclear receptor coactivator 1
Ncoa1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6K7A0A1W2P6K7_MOUSE
Nuclear receptor coactivator 1
Ncoa1
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P881A0A1W2P881_MOUSE
Nuclear receptor coactivator 1
Ncoa1
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45E → G in AAB01228 (PubMed:8616895).Curated1
Sequence conflicti223C → R in AAB06177 (PubMed:9041124).Curated1
Sequence conflicti234E → G in AAB06177 (PubMed:9041124).Curated1
Sequence conflicti237E → K in AAH80866 (PubMed:15489334).Curated1
Sequence conflicti465 – 466SS → TT in AAB01228 (PubMed:8616895).Curated2
Sequence conflicti699Q → P in AAB06177 (PubMed:9041124).Curated1
Sequence conflicti1115L → M in BAC29244 (PubMed:16141072).Curated1
Sequence conflicti1130R → K in AAB01228 (PubMed:8616895).Curated1
Sequence conflicti1137 – 1138RA → KP in AAB01228 (PubMed:8616895).Curated2
Sequence conflicti1142R → K in AAB01228 (PubMed:8616895).Curated1
Sequence conflicti1162T → D in AAB01228 (PubMed:8616895).Curated1
Sequence conflicti1164R → S in AAB06177 (PubMed:9041124).Curated1
Sequence conflicti1166P → L in AAB01228 (PubMed:8616895).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0278551300 – 1376NVFSQ…LYCNQ → KWKRKHSEHESNDGPDANEL SADARDEYCVL in isoform 4. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_0278561377 – 1447Missing in isoform 4. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_0117401392 – 1447QVQQV…QLLTE → DKKTEEFFSVVTTD in isoform 2. 3 PublicationsAdd BLAST56
Alternative sequenceiVSP_0117411392 – 1447QVQQV…QLLTE → VSKKDNPSAELADSITLDTW RTSHGIC in isoform 3. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U56920 mRNA Translation: AAB01228.1
U64606 mRNA Translation: AAB06177.1
U64828 mRNA Translation: AAB38841.1
AK035922 mRNA Translation: BAC29244.1
BC068177 mRNA Translation: AAH68177.1
BC080866 mRNA Translation: AAH80866.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS25789.1 [P70365-2]

NCBI Reference Sequences

More...RefSeqi		NP_035011.1, NM_010881.2 [P70365-2]
XP_006515068.1, XM_006515005.3 [P70365-1]
XP_006515069.1, XM_006515006.3 [P70365-1]
XP_006515070.1, XM_006515007.3 [P70365-1]
XP_011242143.1, XM_011243841.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000085814; ENSMUSP00000082971; ENSMUSG00000020647 [P70365-2]
ENSMUST00000217794; ENSMUSP00000151716; ENSMUSG00000020647 [P70365-4]
ENSMUST00000220434; ENSMUSP00000151358; ENSMUSG00000020647 [P70365-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		17977

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:17977

UCSC genome browser

More...UCSCi		uc007mxr.2, mouse [P70365-1]
uc007mxs.2, mouse [P70365-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U56920 mRNA Translation: AAB01228.1
U64606 mRNA Translation: AAB06177.1
U64828 mRNA Translation: AAB38841.1
AK035922 mRNA Translation: BAC29244.1
BC068177 mRNA Translation: AAH68177.1
BC080866 mRNA Translation: AAH80866.1
CCDSiCCDS25789.1 [P70365-2]
RefSeqiNP_035011.1, NM_010881.2 [P70365-2]
XP_006515068.1, XM_006515005.3 [P70365-1]
XP_006515069.1, XM_006515006.3 [P70365-1]
XP_006515070.1, XM_006515007.3 [P70365-1]
XP_011242143.1, XM_011243841.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OJ5X-ray2.20A257-385[»]
2O9IX-ray2.80C/D686-700[»]
4DMAX-ray2.30E/F690-704[»]
5NWXX-ray2.51A257-385[»]
5Y7WX-ray2.25A/B257-367[»]
AlphaFoldDBiP70365
SMRiP70365
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi201707, 14 interactors
ComplexPortaliCPX-5343, RXRalpha-NCOA1 activated retinoic acid receptor complex
CPX-644, PXR-NCOA1 activated nuclear receptor complex
CPX-667, RARalpha-NCOA1 activated retinoic acid receptor complex
CPX-864, PPARgamma-NCOA1 activated nuclear receptor complex
CORUMiP70365
IntActiP70365, 3 interactors
MINTiP70365
STRINGi10090.ENSMUSP00000082971

PTM databases

iPTMnetiP70365
PhosphoSitePlusiP70365

Proteomic databases

EPDiP70365
jPOSTiP70365
MaxQBiP70365
PaxDbiP70365
PeptideAtlasiP70365
PRIDEiP70365
ProteomicsDBi293632 [P70365-1]
293633 [P70365-2]
293634 [P70365-3]
293635 [P70365-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27525, 422 antibodies from 39 providers

The DNASU plasmid repository

More...DNASUi		17977

Genome annotation databases

EnsembliENSMUST00000085814; ENSMUSP00000082971; ENSMUSG00000020647 [P70365-2]
ENSMUST00000217794; ENSMUSP00000151716; ENSMUSG00000020647 [P70365-4]
ENSMUST00000220434; ENSMUSP00000151358; ENSMUSG00000020647 [P70365-1]
GeneIDi17977
KEGGimmu:17977
UCSCiuc007mxr.2, mouse [P70365-1]
uc007mxs.2, mouse [P70365-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8648
MGIiMGI:1276523, Ncoa1
VEuPathDBiHostDB:ENSMUSG00000020647

Phylogenomic databases

eggNOGiKOG3561, Eukaryota
GeneTreeiENSGT00950000183021
HOGENOMiCLU_001988_0_0_1
InParanoidiP70365
OMAiGVQGQFN
OrthoDBi59971at2759
PhylomeDBiP70365
TreeFamiTF332652

Enzyme and pathway databases

ReactomeiR-MMU-159418, Recycling of bile acids and salts
R-MMU-192105, Synthesis of bile acids and bile salts
R-MMU-193368, Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol
R-MMU-193807, Synthesis of bile acids and bile salts via 27-hydroxycholesterol
R-MMU-211976, Endogenous sterols
R-MMU-3214847, HATs acetylate histones
R-MMU-3899300, SUMOylation of transcription cofactors
R-MMU-400206, Regulation of lipid metabolism by PPARalpha
R-MMU-9018519, Estrogen-dependent gene expression
R-MMU-9029569, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux
R-MMU-9623433, NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis
R-MMU-9707564, Cytoprotection by HMOX1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		17977, 3 hits in 76 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Ncoa1, mouse
EvolutionaryTraceiP70365

Protein Ontology

More...PROi		PR:P70365
RNActiP70365, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000020647, Expressed in rostral migratory stream and 325 other tissues
ExpressionAtlasiP70365, baseline and differential
GenevisibleiP70365, MM

Family and domain databases

CDDicd00130, PAS, 1 hit
Gene3Di4.10.280.10, 1 hit
6.10.140.410, 1 hit
IDEALiIID50084
InterProiView protein in InterPro
IPR011598, bHLH_dom
IPR036638, HLH_DNA-bd_sf
IPR010011, NCO_DUF1518
IPR028819, NCOA1
IPR009110, Nuc_rcpt_coact
IPR014920, Nuc_rcpt_coact_Ncoa-typ
IPR037077, Nuc_rcpt_coact_Ncoa_int_sf
IPR017426, Nuclear_rcpt_coactivator
IPR000014, PAS
IPR035965, PAS-like_dom_sf
IPR013767, PAS_fold
IPR014935, SRC/p160_LXXLL
PANTHERiPTHR10684, PTHR10684, 1 hit
PTHR10684:SF1, PTHR10684:SF1, 1 hit
PfamiView protein in Pfam
PF07469, DUF1518, 2 hits
PF00010, HLH, 1 hit
PF08815, Nuc_rec_co-act, 1 hit
PF00989, PAS, 1 hit
PF08832, SRC-1, 1 hit
PIRSFiPIRSF038181, Nuclear_receptor_coactivator, 1 hit
SMARTiView protein in SMART
SM01151, DUF1518, 2 hits
SM00353, HLH, 1 hit
SM00091, PAS, 1 hit
SUPFAMiSSF47459, SSF47459, 1 hit
SSF55785, SSF55785, 2 hits
SSF69125, SSF69125, 1 hit
PROSITEiView protein in PROSITE
PS50888, BHLH, 1 hit
PS50112, PAS, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCOA1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P70365
Secondary accession number(s): P70366
, Q61202, Q66JL7, Q8CBI9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: October 11, 2004
Last modified: May 25, 2022
This is version 202 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again