Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-like protein 2

Gene

Bcl2l2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.3 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processApoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-like protein 2
Short name:
Bcl2-L-2
Alternative name(s):
Apoptosis regulator Bcl-W
c98
Gene namesi
Name:Bcl2l2
Synonyms:Bclw, Kiaa0271
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:108052 Bcl2l2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Disruption phenotypei

Mice are sterile due to arrest in spermatogenesis associated with a gradual loss of germ and Sertoli cells from the testis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001430672 – 193Bcl-2-like protein 2Add BLAST192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP70345
PaxDbiP70345
PeptideAtlasiP70345
PRIDEiP70345

PTM databases

PhosphoSitePlusiP70345

Expressioni

Tissue specificityi

Expressed in almost all myeloid cell lines and in a wide range of tissues, with highest levels in brain, colon, and salivary gland.

Developmental stagei

Expressed in both mitotic and postmitotic Sertoli cells.1 Publication

Inductioni

By Igf1.1 Publication

Gene expression databases

BgeeiENSMUSG00000089682 Expressed in 287 organ(s), highest expression level in retina
CleanExiMM_BCL2L2
ExpressionAtlasiP70345 baseline and differential
GenevisibleiP70345 MM

Interactioni

Subunit structurei

Interacts with HIF3A isoform 2 (via C-terminus domain) (PubMed:21546903). Interacts with BOP (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi198325, 3 interactors
ComplexPortaliCPX-310 BIK:BCL-w complex
STRINGi10090.ENSMUSP00000022806

Structurei

3D structure databases

ProteinModelPortaliP70345
SMRiP70345
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi9 – 29BH4Add BLAST21
Motifi85 – 104BH1Add BLAST20
Motifi136 – 151BH2Add BLAST16

Domaini

The BH4 motif seems to be involved in the anti-apoptotic function.
The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. The C-terminal residues of BCL2L2 fold into the BH3-binding cleft and modulate pro-survival activity by regulating ligand access. When BH3 domain-containing proteins bind, they displace the C-terminus, allowing its insertion into the membrane and neutralizing the pro-survival activity of BCL2L2 (By similarity).By similarity

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiKOG4209 Eukaryota
ENOG4111PFV LUCA
GeneTreeiENSGT00530000062935
HOGENOMiHOG000056452
InParanoidiP70345
KOiK02163
OMAiWMVVYLE
OrthoDBiEOG091G0PAK
PhylomeDBiP70345
TreeFamiTF315834

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR013280 Apop_reg_BclW
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR003093 Bcl2_BH4
IPR020731 Bcl2_BH4_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF13 PTHR11256:SF13, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PF02180 BH4, 1 hit
PRINTSiPR01865 APOPREGBCLW
PR01862 BCL2FAMILY
SMARTiView protein in SMART
SM00265 BH4, 1 hit
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01260 BH4_1, 1 hit
PS50063 BH4_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P70345-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATPASTPDT RALVADFVGY KLRQKGYVCG AGPGEGPAAD PLHQAMRAAG
60 70 80 90 100
DEFETRFRRT FSDLAAQLHV TPGSAQQRFT QVSDELFQGG PNWGRLVAFF
110 120 130 140 150
VFGAALCAES VNKEMEPLVG QVQDWMVAYL ETRLADWIHS SGGWAEFTAL
160 170 180 190
YGDGALEEAR RLREGNWASV RTVLTGAVAL GALVTVGAFF ASK
Length:193
Mass (Da):20,790
Last modified:February 1, 1997 - v1
Checksum:i36CA185F5945DFB4
GO
Isoform 2 (identifier: P70345-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-193: AEFTALYGDG...VTVGAFFASK → VRSSQLLLSASLYKVGLHGKIGPLMGGWGCAGKG

Show »
Length:178
Mass (Da):19,119
Checksum:iE2C3F3F79528E9D7
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3XA70G3XA70_MOUSE
Bcl-2-like protein 2
Bcl2l2
79Annotation score:
A0A2I3BR11A0A2I3BR11_MOUSE
Bcl-2-like protein 2
Bcl2l2
117Annotation score:

Sequence cautioni

The sequence BAD32203 differs from that shown. Reason: Frameshift at position 191.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti16D → Y in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti21K → Q in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti53 – 54FE → LQ in AAO13177 (PubMed:14746907).Curated2
Sequence conflicti63D → H in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti114E → H in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti136D → Y in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti192S → Y in AAO13177 (PubMed:14746907).Curated1
Isoform 2 (identifier: P70345-2)
Sequence conflicti177K → R in BAB28740 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014780145 – 193AEFTA…FFASK → VRSSQLLLSASLYKVGLHGK IGPLMGGWGCAGKG in isoform 2. 2 PublicationsAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59746 mRNA Translation: AAB09056.1
AF030769 mRNA Translation: AAB86430.1
AY170344 mRNA Translation: AAO13177.2
AK004680 mRNA Translation: BAB23468.1
AK013244 mRNA Translation: BAB28740.1
AK015644 mRNA Translation: BAB29912.1
AK172925 mRNA Translation: BAD32203.1 Frameshift.
BC040369 mRNA Translation: AAH40369.1
CCDSiCCDS27103.1 [P70345-1]
RefSeqiNP_031563.1, NM_007537.1 [P70345-1]
XP_006518520.1, XM_006518457.3 [P70345-1]
XP_006518521.1, XM_006518458.2 [P70345-1]
UniGeneiMm.397611
Mm.6967

Genome annotation databases

EnsembliENSMUST00000022806; ENSMUSP00000022806; ENSMUSG00000089682 [P70345-1]
ENSMUST00000133397; ENSMUSP00000116385; ENSMUSG00000089682 [P70345-2]
GeneIDi12050
KEGGimmu:12050
UCSCiuc007txe.1 mouse [P70345-1]
uc007txf.1 mouse [P70345-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59746 mRNA Translation: AAB09056.1
AF030769 mRNA Translation: AAB86430.1
AY170344 mRNA Translation: AAO13177.2
AK004680 mRNA Translation: BAB23468.1
AK013244 mRNA Translation: BAB28740.1
AK015644 mRNA Translation: BAB29912.1
AK172925 mRNA Translation: BAD32203.1 Frameshift.
BC040369 mRNA Translation: AAH40369.1
CCDSiCCDS27103.1 [P70345-1]
RefSeqiNP_031563.1, NM_007537.1 [P70345-1]
XP_006518520.1, XM_006518457.3 [P70345-1]
XP_006518521.1, XM_006518458.2 [P70345-1]
UniGeneiMm.397611
Mm.6967

3D structure databases

ProteinModelPortaliP70345
SMRiP70345
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198325, 3 interactors
ComplexPortaliCPX-310 BIK:BCL-w complex
STRINGi10090.ENSMUSP00000022806

PTM databases

PhosphoSitePlusiP70345

Proteomic databases

MaxQBiP70345
PaxDbiP70345
PeptideAtlasiP70345
PRIDEiP70345

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022806; ENSMUSP00000022806; ENSMUSG00000089682 [P70345-1]
ENSMUST00000133397; ENSMUSP00000116385; ENSMUSG00000089682 [P70345-2]
GeneIDi12050
KEGGimmu:12050
UCSCiuc007txe.1 mouse [P70345-1]
uc007txf.1 mouse [P70345-2]

Organism-specific databases

CTDi599
MGIiMGI:108052 Bcl2l2
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4209 Eukaryota
ENOG4111PFV LUCA
GeneTreeiENSGT00530000062935
HOGENOMiHOG000056452
InParanoidiP70345
KOiK02163
OMAiWMVVYLE
OrthoDBiEOG091G0PAK
PhylomeDBiP70345
TreeFamiTF315834

Miscellaneous databases

ChiTaRSiBcl2l2 mouse
PROiPR:P70345
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000089682 Expressed in 287 organ(s), highest expression level in retina
CleanExiMM_BCL2L2
ExpressionAtlasiP70345 baseline and differential
GenevisibleiP70345 MM

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR013280 Apop_reg_BclW
IPR002475 Bcl2-like
IPR020717 Bcl2_BH1_motif_CS
IPR020726 Bcl2_BH2_motif_CS
IPR003093 Bcl2_BH4
IPR020731 Bcl2_BH4_motif_CS
IPR036834 Blc2-like_sf
IPR026298 Blc2_fam
PANTHERiPTHR11256 PTHR11256, 1 hit
PTHR11256:SF13 PTHR11256:SF13, 1 hit
PfamiView protein in Pfam
PF00452 Bcl-2, 1 hit
PF02180 BH4, 1 hit
PRINTSiPR01865 APOPREGBCLW
PR01862 BCL2FAMILY
SMARTiView protein in SMART
SM00265 BH4, 1 hit
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS50062 BCL2_FAMILY, 1 hit
PS01080 BH1, 1 hit
PS01258 BH2, 1 hit
PS01260 BH4_1, 1 hit
PS50063 BH4_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiB2CL2_MOUSE
AccessioniPrimary (citable) accession number: P70345
Secondary accession number(s): Q545Q4
, Q6A093, Q8CFR2, Q8CGL4, Q9CYW5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: November 7, 2018
This is version 154 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again