Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CTP synthase 2

Gene

Ctps2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides (By similarity).By similarity

Catalytic activityi

ATP + UTP + L-glutamine = ADP + phosphate + CTP + L-glutamate.

Pathwayi: CTP biosynthesis via de novo pathway

This protein is involved in step 2 of the subpathway that synthesizes CTP from UDP.
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. no protein annotated in this organism
  2. CTP synthase 2 (Ctps2), CTP synthase 1 (Ctps1)
This subpathway is part of the pathway CTP biosynthesis via de novo pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CTP from UDP, the pathway CTP biosynthesis via de novo pathway and in Pyrimidine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei399For GATase activityPROSITE-ProRule annotation1
Active sitei526For GATase activityPROSITE-ProRule annotation1
Active sitei528For GATase activityPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionLigase
Biological processPyrimidine biosynthesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi6.3.4.2 3474
ReactomeiR-MMU-499943 Interconversion of nucleotide di- and triphosphates
UniPathwayiUPA00159; UER00277

Names & Taxonomyi

Protein namesi
Recommended name:
CTP synthase 2 (EC:6.3.4.2)
Alternative name(s):
CTP synthetase 2
Short name:
CTPsH
UTP--ammonia ligase 2
Gene namesi
Name:Ctps2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1933185 Ctps2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002470341 – 586CTP synthase 2Add BLAST586

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei568PhosphoserineCombined sources1
Modified residuei571PhosphoserineCombined sources1
Modified residuei574PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP70303
MaxQBiP70303
PaxDbiP70303
PeptideAtlasiP70303
PRIDEiP70303

PTM databases

iPTMnetiP70303
PhosphoSitePlusiP70303

Expressioni

Gene expression databases

BgeeiENSMUSG00000031360
CleanExiMM_CTPS2
ExpressionAtlasiP70303 baseline and differential
GenevisibleiP70303 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033727

Structurei

3D structure databases

ProteinModelPortaliP70303
SMRiP70303
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini300 – 554Glutamine amidotransferase type-1PROSITE-ProRule annotationAdd BLAST255

Sequence similaritiesi

Belongs to the CTP synthase family.Curated

Keywords - Domaini

Glutamine amidotransferase

Phylogenomic databases

eggNOGiKOG2387 Eukaryota
COG0504 LUCA
GeneTreeiENSGT00910000144179
HOGENOMiHOG000077514
HOVERGENiHBG002243
InParanoidiP70303
KOiK01937
OMAiFSEPRIA
OrthoDBiEOG091G03OK
PhylomeDBiP70303
TreeFamiTF300379

Family and domain databases

CDDicd01746 GATase1_CTP_Synthase, 1 hit
Gene3Di3.40.50.880, 1 hit
InterProiView protein in InterPro
IPR029062 Class_I_gatase-like
IPR004468 CTP_synthase
IPR017456 CTP_synthase_N
IPR017926 GATASE
IPR033828 GATase1_CTP_Synthase
IPR027417 P-loop_NTPase
PANTHERiPTHR11550 PTHR11550, 1 hit
PfamiView protein in Pfam
PF06418 CTP_synth_N, 1 hit
PF00117 GATase, 1 hit
SUPFAMiSSF52317 SSF52317, 1 hit
SSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00337 PyrG, 1 hit
PROSITEiView protein in PROSITE
PS51273 GATASE_TYPE_1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P70303-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKYILVTGGV ISGIGKGIIA SSIGTILKSC GLRVTAIKID PYINIDAGTF
60 70 80 90 100
SPYEHGEVFV LNDGGEVDLD LGNYERFLDI NLYKDNNITT GKIYQHVINK
110 120 130 140 150
ERRGDYLGKT VQVVPHITDA IQEWVMNQAK VSVDGNKEDP QICVIELGGT
160 170 180 190 200
IGDIEGMAFV EAFRQFQFKA KKENFYNIHV SLVPQPSATG EQKTKPTQNS
210 220 230 240 250
VRALRGLGLS PDLIVCRSST PIEMAVKEKI SMFCHVNPEQ VICIHDVSSI
260 270 280 290 300
YRVPLLLEEQ GVVKYFQERL GLPINDCSSN LLFKWKAMAD RYERLQKICS
310 320 330 340 350
IALVGKYTKL RDCYASVFKA LEHSALAINH KLNLMYIDSI DLEPVTKAED
360 370 380 390 400
PVKFHEAWQK LCLADGILVP GGFGIRGTLG KLQAISWART KKIPFLGICL
410 420 430 440 450
GMQLAVIEFA RNCLNLKDAN STEFEPNTPV PLVIDMPEHN PGDLGGTMRL
460 470 480 490 500
GLRRTVFTTE NSILKKLYGD VPYIEERHRH RYEVNPNLIN QFENKDLCFV
510 520 530 540 550
GEDVDGKRME IVELTSHPYF IGVQFHPEFS SRPMKPSPPY LGLLLAATGN
560 570 580
LNAHLQQMNK LPYSDGYSDA SDDSFPEAKL AELDLN
Length:586
Mass (Da):65,514
Last modified:February 1, 1997 - v1
Checksum:i52EC0237B84A05F9
GO
Isoform 2 (identifier: P70303-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     465-515: Missing.

Note: No experimental confirmation available.
Show »
Length:535
Mass (Da):59,382
Checksum:i8C3C5836241FA589
GO
Isoform 3 (identifier: P70303-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGSELLGKNSALFSSFPTFCGGGPLGCTVADGQTFMIASGYWQSPIRPPM
     465-472: KKLYGDVP → SLYLQCSG
     473-586: Missing.

Note: No experimental confirmation available.
Show »
Length:521
Mass (Da):57,466
Checksum:i03AB836A6AE17F58
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0198931M → MGSELLGKNSALFSSFPTFC GGGPLGCTVADGQTFMIASG YWQSPIRPPM in isoform 3. 1 Publication1
Alternative sequenceiVSP_019894465 – 515Missing in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_019895465 – 472KKLYGDVP → SLYLQCSG in isoform 3. 1 Publication8
Alternative sequenceiVSP_019896473 – 586Missing in isoform 3. 1 PublicationAdd BLAST114

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49385 mRNA Translation: AAB17729.1
AK032018 mRNA Translation: BAC27651.1
AK052854 mRNA Translation: BAC35174.1
AK084595 mRNA Translation: BAC39223.1
AK150966 mRNA Translation: BAE29997.1
AK151597 mRNA Translation: BAE30537.1
AK161564 mRNA Translation: BAE36466.1
AK164206 mRNA Translation: BAE37683.1
BC003257 mRNA Translation: AAH03257.1
CCDSiCCDS41202.1 [P70303-1]
CCDS53240.1 [P70303-2]
RefSeqiNP_001162040.1, NM_001168568.1 [P70303-1]
NP_001162041.1, NM_001168569.1 [P70303-1]
NP_001162043.1, NM_001168571.1 [P70303-2]
NP_061207.1, NM_018737.5 [P70303-1]
XP_006528975.1, XM_006528912.2 [P70303-1]
XP_006528976.1, XM_006528913.2 [P70303-1]
UniGeneiMm.2065

Genome annotation databases

EnsembliENSMUST00000033727; ENSMUSP00000033727; ENSMUSG00000031360 [P70303-1]
ENSMUST00000101095; ENSMUSP00000098656; ENSMUSG00000031360 [P70303-3]
ENSMUST00000112301; ENSMUSP00000107920; ENSMUSG00000031360 [P70303-1]
ENSMUST00000112302; ENSMUSP00000107921; ENSMUSG00000031360 [P70303-2]
ENSMUST00000112303; ENSMUSP00000107922; ENSMUSG00000031360 [P70303-1]
GeneIDi55936
KEGGimmu:55936
UCSCiuc009uuo.2 mouse [P70303-1]
uc012hrk.1 mouse [P70303-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPYRG2_MOUSE
AccessioniPrimary (citable) accession number: P70303
Secondary accession number(s): Q3TPQ2, Q3TT59
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: February 1, 1997
Last modified: May 23, 2018
This is version 144 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health