Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (13 Feb 2019)
Sequence version 2 (03 Oct 2012)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Neural cell adhesion molecule L1-like protein

Gene

Chl1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Extracellular matrix and cell adhesion protein that plays a role in nervous system development and in synaptic plasticity. Both soluble and membranous forms promote neurite outgrowth of cerebellar and hippocampal neurons and suppress neuronal cell death. Plays a role in neuronal positioning of pyramidal neurons as well as in regulation of both the number of interneurons and the efficacy of GABAergic synapses. May play a role in regulating cell migration in nerve regeneration and cortical development. Potentiates integrin-dependent cell migration towards extracellular matrix proteins. Recruits ANK3 to the plasma membrane.9 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protease binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCell adhesion, Differentiation, Neurogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neural cell adhesion molecule L1-like protein
Alternative name(s):
Cell adhesion molecule with homology to L1CAM
Chl1-like protein
Close homolog of L1
Cleaved into the following chain:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Chl1
Synonyms:Call
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1098266 Chl1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 1083ExtracellularSequence analysisAdd BLAST1058
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1084 – 1104HelicalSequence analysisAdd BLAST21
Topological domaini1105 – 1209CytoplasmicSequence analysisAdd BLAST105

Keywords - Cellular componenti

Cell membrane, Extracellular matrix, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice exhibit misguided axonal projections and aberrant axonal connectivity. They show alterations of hippocampal fiber organization and olfactory axon projections. Their exploratory behavior in novel environments is altered suggesting deficits in information processing and in attention. They also display signs of decreased stress and are more sociable and less aggressive. Heterozygous mice exhibit half levels of CHL1 expression in the hippocampus compared to their wild-type littermates, reflecting a gene dosage effect.4 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi555 – 558DGEA → AGEV: Inhibition of migration potentiation. 1 Publication4
Mutagenesisi1186Y → A: Inhibition of migration potentiation. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024789726 – 1209Neural cell adhesion molecule L1-like proteinAdd BLAST1184
ChainiPRO_000031477826 – ?Processed neural cell adhesion molecule L1-like proteinSequence analysis

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi57 ↔ 109PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi87N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi153 ↔ 204PROSITE-ProRule annotation
Glycosylationi225N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi262 ↔ 310PROSITE-ProRule annotation
Glycosylationi299N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi352 ↔ 401PROSITE-ProRule annotation
Disulfide bondi445 ↔ 494PROSITE-ProRule annotation
Glycosylationi476N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi536 ↔ 591PROSITE-ProRule annotation
Glycosylationi562N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi580N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi767N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi822N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi945N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1027N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1148PhosphoserineCombined sources1
Modified residuei1161PhosphoserineCombined sources1
Modified residuei1181PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Cleavage by metalloprotease ADAM8 in the extracellular part generates 2 soluble forms (125 kDa and 165 kDa) in vitro and is inhibited by metalloprotease inhibitors. In brain extracts, these two soluble forms are also present and are dramatically reduced in mice lacking ADAM8.
N-glycosylated. Contains N-linked oligosaccharides with a sulfated carbohydrate structure type HNK-1 (SO4-3-GlcUABeta1,3GalBeta1,4GlcNAc).1 Publication
O-glycosylated.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei753 – 754Cleavage; by ADAM82
Sitei1040 – 1041Cleavage; by ADAM82

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P70232

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P70232

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P70232

PeptideAtlas

More...
PeptideAtlasi
P70232

PRoteomics IDEntifications database

More...
PRIDEi
P70232

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P70232

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P70232

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the brain, in the cerebellum and in the spinal cord. Detected in the retina and the optic nerve. Expressed in neurons and glial cells in the central nervous system and by Schwann cells in the peripheral nervous system.3 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Not detectable in the forebrain at 11 dpc, weakly detectable at 13 dpc with highest detection at 18 dpc to postnatal day 7. Down-regulated at postnatal day 15 and further reduced in four-week-old animals.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000030077 Expressed in 204 organ(s), highest expression level in Ammon's horn

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P70232 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P70232 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May interact with L1CAM. May interact with ITGB1/ITGA1 heterodimer and ITGB1/ITGA2 heterodimer as well as with ANK3.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
198702, 1 interactor

Protein interaction database and analysis system

More...
IntActi
P70232, 3 interactors

Molecular INTeraction database

More...
MINTi
P70232

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000063933

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P70232

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P70232

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 124Ig-like C2-type 1Add BLAST90
Domaini128 – 223Ig-like C2-type 2Add BLAST96
Domaini235 – 328Ig-like C2-type 3Add BLAST94
Domaini331 – 417Ig-like C2-type 4Add BLAST87
Domaini423 – 510Ig-like C2-type 5Add BLAST88
Domaini515 – 607Ig-like C2-type 6Add BLAST93
Domaini614 – 709Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST96
Domaini714 – 807Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94
Domaini812 – 914Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST103
Domaini918 – 1015Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi555 – 558DGEA4
Motifi1182 – 1186FIG[AQ]Y5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The FIG[AQ]Y motif seems to be an ankyrin recruitment region.
The DGEA motif seems to be a recognition site for integrin.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3513 Eukaryota
ENOG410XSVG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160080

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231380

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000144

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P70232

KEGG Orthology (KO)

More...
KOi
K06758

Identification of Orthologs from Complete Genome Data

More...
OMAi
DMQATES

TreeFam database of animal gene trees

More...
TreeFami
TF351098

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 4 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 10 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR026966 Neurofascin/L1/NrCAM_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13882 Bravo_FIGEY, 1 hit
PF00041 fn3, 4 hits
PF07679 I-set, 2 hits
PF13895 Ig_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 4 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 6 hits
SSF49265 SSF49265, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 4 hits
PS50835 IG_LIKE, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P70232-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMELPLCGRG LILSLIFLLL KLSAAEIPLS VQQVPTIVKQ SYVQVAFPFD
60 70 80 90 100
EYFQIECEAK GNPEPIFSWT KDDKPFDLSD PRIIAANNSG TFKIPNEGHI
110 120 130 140 150
SHFQGKYRCF ASNRLGTAVS EEIEFIVPGV PKFPKEKIEP IDVEEGDSIV
160 170 180 190 200
LPCNPPKGLP PLHIYWMNIE LEHIEQDERV YMSQRGDLYF ANVEENDSRN
210 220 230 240 250
DYCCFAAFPK LRTIVQKMPM KLTVNSSNSI KQRKPKLLLP PAQMGSLSAK
260 270 280 290 300
TVLKGDTLLL ECFAEGLPTP HIQWSKPGSE LPEGRATIEV HEKTLKIENI
310 320 330 340 350
SYQDRGNYRC TANNLLGKAS HDFHVTVEEP PRWKKKPQSA VYSTGSSGIL
360 370 380 390 400
LCEAEGEPQP TIKWRLNGLP IEKHPFPGDF MFPREISFTN LLPNHTGVYQ
410 420 430 440 450
CEASNIHGTI LANANIDVID VIPLIKTKNE ENYATVVGYS AFLHCEYFAS
460 470 480 490 500
PKATVVWEVA DETHPLEGDR YHTHENGTLE IYRTTEEDAG SYSCWVDNAM
510 520 530 540 550
GKAVITANLD IRNATKLRVS PKNPRIPKSH VLELYCESQC DSHLKHSLKL
560 570 580 590 600
SWSKDGEAFE MNGTEDGRIV IDGAYLTISN ITAEDQGVYS CSAQTSLDST
610 620 630 640 650
SEKTQVTVLG VPDPPGNLHL SERQNRSVRL SWEAGDDHNS KISEYIVEFE
660 670 680 690 700
GNREEPGKWE ELTRVQGEET DVVLSLAPYV RYQFRVTAVN EVGRSHASLP
710 720 730 740 750
SDHHETPPAA PDKNPQNIRV QASQPKEMII KWEPLKSMEQ NGPGLEYKVS
760 770 780 790 800
WKPQGAPEEW EEEIVTNHTL RVMTPTVYAP YDVKVQAINQ LGSSPDPQPV
810 820 830 840 850
TLYSGEDYPS TAPVIQRVDV MNSTLVKVTW SSIPKETVHG LLRGYQINWW
860 870 880 890 900
KTKSLLDGRT HPKEVNILRF SGQRNSGMVP SLDPFSEFHL TVLAYNSKGA
910 920 930 940 950
GPESEPYIFQ TPEGVPEQPS FLKVIKVDKD TATLSWGLPK KLNGNLTGYL
960 970 980 990 1000
LQYQIINDTY ELGELNEINV TTPSKSSWHL SNLNSTTKYK FYLRACTSRG
1010 1020 1030 1040 1050
CGKPISEEGA TLGEGSKGIR KITEGVNVTQ KIHPVEVLVP GAEHIVHLMT
1060 1070 1080 1090 1100
KNWGDNDSIF QDVIETRGRE YAGLYDDIST QGWFIGLMCA IALLTLILLT
1110 1120 1130 1140 1150
ICFVKRNRGG KYSVKEKEDL HPDPEVQSAK DETFGEYSDS DEKPLKGSLR
1160 1170 1180 1190 1200
SLNRNMQPTE SADSLVEYGE GDQSIFNEDG SFIGAYTGAK EKGSVESNGS

STATFPLRA
Length:1,209
Mass (Da):135,074
Last modified:October 3, 2012 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2C689475920AB84C
GO
Isoform 2 (identifier: P70232-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: S → LKHASDSSSSTEICSQA
     1016-1070: SKGIRKITEGVNVTQKIHPVEVLVPGAEHIVHLMTKNWGDNDSIFQDVIETRGRE → K
     1138-1209: SDSDEKPLKG...SSTATFPLRA → RKMVLKQKLL...LRYFSSNKHT

Show »
Length:1,150
Mass (Da):129,001
Checksum:i6CF6C082529C7A99
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0N4SUM4A0A0N4SUM4_MOUSE
Neural cell adhesion molecule L1-li...
Chl1
428Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0N4SUL1A0A0N4SUL1_MOUSE
Neural cell adhesion molecule L1-li...
Chl1
152Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC30699 differs from that shown. Reason: Frameshift at positions 616, 624, 631, 632, 642 and 645.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti50D → G in BAC35247 (PubMed:16141072).Curated1
Sequence conflicti77D → E in CAC88131 (PubMed:12391163).Curated1
Sequence conflicti425I → V in BAC35247 (PubMed:16141072).Curated1
Sequence conflicti602E → K in CAA63972 (PubMed:8921253).Curated1
Sequence conflicti612P → G in CAA63972 (PubMed:8921253).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_020083227S → LKHASDSSSSTEICSQA in isoform 2. 1 Publication1
Alternative sequenceiVSP_0200841016 – 1070SKGIR…TRGRE → K in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0200851138 – 1209SDSDE…FPLRA → RKMVLKQKLLSWSSSRGRTF YSCTKNTLFDGSSVDMKTLQ PLRYFSSNKHT in isoform 2. 1 PublicationAdd BLAST72

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X94310 mRNA Translation: CAA63972.1
AK040765 mRNA Translation: BAC30699.1 Frameshift.
AK048639 mRNA Translation: BAC33405.1
AK053039 mRNA Translation: BAC35247.2
AC153595 Genomic DNA No translation available.
AC153598 Genomic DNA No translation available.
AC161824 Genomic DNA No translation available.
CH466523 Genomic DNA Translation: EDK99388.1
BC131670 mRNA Translation: AAI31671.1
BC131671 mRNA Translation: AAI31672.1
AJ319655, AJ319656, AJ319657 Genomic DNA Translation: CAC88131.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39582.1 [P70232-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T42718

NCBI Reference Sequences

More...
RefSeqi
NP_031723.2, NM_007697.2 [P70232-1]
XP_006505535.1, XM_006505472.3 [P70232-1]
XP_017176864.1, XM_017321375.1 [P70232-1]
XP_017176865.1, XM_017321376.1 [P70232-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.251288

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077 [P70232-1]
ENSMUST00000203830; ENSMUSP00000144758; ENSMUSG00000030077 [P70232-1]
ENSMUST00000203912; ENSMUSP00000145026; ENSMUSG00000030077 [P70232-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12661

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12661

UCSC genome browser

More...
UCSCi
uc009dcj.1 mouse [P70232-1]
uc009dck.1 mouse [P70232-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X94310 mRNA Translation: CAA63972.1
AK040765 mRNA Translation: BAC30699.1 Frameshift.
AK048639 mRNA Translation: BAC33405.1
AK053039 mRNA Translation: BAC35247.2
AC153595 Genomic DNA No translation available.
AC153598 Genomic DNA No translation available.
AC161824 Genomic DNA No translation available.
CH466523 Genomic DNA Translation: EDK99388.1
BC131670 mRNA Translation: AAI31671.1
BC131671 mRNA Translation: AAI31672.1
AJ319655, AJ319656, AJ319657 Genomic DNA Translation: CAC88131.1
CCDSiCCDS39582.1 [P70232-1]
PIRiT42718
RefSeqiNP_031723.2, NM_007697.2 [P70232-1]
XP_006505535.1, XM_006505472.3 [P70232-1]
XP_017176864.1, XM_017321375.1 [P70232-1]
XP_017176865.1, XM_017321376.1 [P70232-1]
UniGeneiMm.251288

3D structure databases

ProteinModelPortaliP70232
SMRiP70232
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198702, 1 interactor
IntActiP70232, 3 interactors
MINTiP70232
STRINGi10090.ENSMUSP00000063933

PTM databases

iPTMnetiP70232
PhosphoSitePlusiP70232

Proteomic databases

jPOSTiP70232
MaxQBiP70232
PaxDbiP70232
PeptideAtlasiP70232
PRIDEiP70232

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000066905; ENSMUSP00000063933; ENSMUSG00000030077 [P70232-1]
ENSMUST00000203830; ENSMUSP00000144758; ENSMUSG00000030077 [P70232-1]
ENSMUST00000203912; ENSMUSP00000145026; ENSMUSG00000030077 [P70232-2]
GeneIDi12661
KEGGimmu:12661
UCSCiuc009dcj.1 mouse [P70232-1]
uc009dck.1 mouse [P70232-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10752
MGIiMGI:1098266 Chl1

Phylogenomic databases

eggNOGiKOG3513 Eukaryota
ENOG410XSVG LUCA
GeneTreeiENSGT00940000160080
HOGENOMiHOG000231380
HOVERGENiHBG000144
InParanoidiP70232
KOiK06758
OMAiDMQATES
TreeFamiTF351098

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P70232

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000030077 Expressed in 204 organ(s), highest expression level in Ammon's horn
ExpressionAtlasiP70232 baseline and differential
GenevisibleiP70232 MM

Family and domain databases

CDDicd00063 FN3, 4 hits
Gene3Di2.60.40.10, 10 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR026966 Neurofascin/L1/NrCAM_C
PfamiView protein in Pfam
PF13882 Bravo_FIGEY, 1 hit
PF00041 fn3, 4 hits
PF07679 I-set, 2 hits
PF13895 Ig_2, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 4 hits
SM00409 IG, 5 hits
SM00408 IGc2, 5 hits
SUPFAMiSSF48726 SSF48726, 6 hits
SSF49265 SSF49265, 2 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 4 hits
PS50835 IG_LIKE, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCHL1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P70232
Secondary accession number(s): A2RRK1
, Q8BS24, Q8C6W0, Q8C823, Q8VBY7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: October 3, 2012
Last modified: February 13, 2019
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again