UniProtKB - P69795 (PTQB_ECOLI)

BLAST

>sp|P69795|PTQB_ECOLI PTS system N,N'-diacetylchitobiose-specific EIIB component OS=Escherichia coli (strain K12) OX=83333 GN=chbB PE=1 SV=1
MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI
AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN

Align
Format
Add to basket Added to basket
History
Entry version 106 (28 Mar 2018)
Sequence version 1 (10 May 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

PTS system N,N'-diacetylchitobiose-specific EIIB component

Gene

chbB

Organism

Escherichia coli (strain K12)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The enzyme II ChbABC PTS system is involved in the transport of the chitin disaccharide N,N'-diacetylchitobiose (GlcNAc2) (PubMed:10913117). Also able to use N,N',N''-triacetyl chitotriose (GlcNAc3) (PubMed:10913117, PubMed:10913119).1 Publication2 Publications

Caution

Was originally (PubMed:2092358) characterized as part of a cryptic cel operon for a cellobiose degradation system. The Cel+ phenotype is due to mutations making expression chitobiose-independent and altering the substrate specificity.1 Publication

Catalytic activityⁱ

[Protein]-N(pi)-phospho-L-histidine + N,N'-diacetylchitobiose(Side 1) = [protein]-L-histidine + N,N'-diacetylchitobiose 6'-phosphate(Side 2).2 Publications

Sites

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Active siteⁱ	10	Phosphocysteine intermediate5 Publications2 Publications		1

GO - Molecular functionⁱ

kinase activity Source: UniProtKB-KW
protein-N(PI)-phosphohistidine-sugar phosphotransferase activity Source: InterPro
protein-phosphocysteine-N,N'-diacetylchitobiose phosphotransferase system transporter activity
Source: EcoCyc
Inferred from direct assayⁱ
- 10913119

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

N,N'-diacetylchitobiose import
Source: EcoCyc
Inferred from direct assayⁱ
- 10913117
phosphoenolpyruvate-dependent sugar phosphotransferase system
Source: EcoCyc
Inferred from direct assayⁱ
- 10913117

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Kinase, Transferase
Biological process	Phosphotransferase system, Sugar transport, Transport

Enzyme and pathway databases

BioCycⁱ	EcoCyc:CELA-MONOMER MetaCyc:CELA-MONOMER

BioCycⁱ

EcoCyc:CELA-MONOMER
MetaCyc:CELA-MONOMER

Protein family/group databases

TCDBⁱ	4.A.3.2.1 the pts lactose-n,n'-diacetylchitobiose-Beta-glucoside (lac) family

TCDBⁱ

4.A.3.2.1 the pts lactose-n,n'-diacetylchitobiose-Beta-glucoside (lac) family

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: PTS system N,N'-diacetylchitobiose-specific EIIB component1 Publication Alternative name(s): EIIB-Chb1 Publication IVcel1 Publication N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB component1 Publication (EC:2.7.1.1962 Publications)
Gene namesⁱ	Name:chbB1 Publication Synonyms:celA1 Publication Ordered Locus Names:b1738, JW1727
Organismⁱ	Escherichia coli (strain K12)
Taxonomic identifierⁱ	83333 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli
Proteomesⁱ	UP000000318 Componentⁱ: Chromosome UP000000625 Componentⁱ: Chromosome

Organism-specific databases

EcoGeneⁱ	EG10140 chbB

EcoGeneⁱ

EG10140 chbB

Subcellular locationⁱ

Cytoplasm Curated

GO - Cellular componentⁱ

cytosol
Source: EcoCyc
Inferred from direct assayⁱ
- 10913122

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	10	C → S: Unable to be phosphorylated by EIIA. 2 Publications		1

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB03544 S-Phosphocysteine

DrugBankⁱ

DB03544 S-Phosphocysteine

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000186489	1 – 106	PTS system N,N'-diacetylchitobiose-specific EIIB componentAdd BLAST		106

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	10	Phosphocysteine; by EIIAPROSITE-ProRule annotation1 Publication		1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

PaxDbⁱ	P69795
PRIDEⁱ	P69795

PTM databases

iPTMnetⁱ	P69795

iPTMnetⁱ

P69795

Expressionⁱ

Inductionⁱ

By GlcNAc2, GlcNAc3 and beta-N,N'-diacetylchitobiose (Me-TCB).1 Publication

Interactionⁱ

Subunit structureⁱ

Forms a complex with ChbA (EIIA) (PubMed:10913119, PubMed:10913122, PubMed:19959833). ChbB is a monomer in both its unphosphorylated and phosphorylated forms (PubMed:10913122).3 Publications

Protein-protein interaction databases

BioGridⁱ	4260316, 17 interactors
IntActⁱ	P69795, 1 interactor
STRINGⁱ	316385.ECDH10B_1876

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	4 – 11	Combined sources	8
Helixⁱ	13 – 29	Combined sources	17
Beta strandⁱ	34 – 40	Combined sources	7
Helixⁱ	41 – 43	Combined sources	3
Helixⁱ	44 – 48	Combined sources	5
Beta strandⁱ	52 – 56	Combined sources	5
Helixⁱ	58 – 63	Combined sources	6
Helixⁱ	64 – 70	Combined sources	7
Beta strandⁱ	71 – 74	Combined sources	4
Beta strandⁱ	76 – 78	Combined sources	3
Helixⁱ	81 – 85	Combined sources	5
Helixⁱ	89 – 104	Combined sources	16

Show more details

3D structure databases

ProteinModelPortalⁱ	P69795
SMRⁱ	P69795
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P69795

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	3 – 106	PTS EIIB type-3PROSITE-ProRule annotationAdd BLAST		104

Domainⁱ

The PTS EIIB type-3 domain is phosphorylated by phospho-EIIA on a cysteinyl residue. Then, it transfers the phosphoryl group to the sugar substrate concomitantly with the sugar uptake processed by the PTS EIIC type-3 domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGⁱ	ENOG4105VZJ Bacteria COG1440 LUCA
HOGENOMⁱ	HOG000224223
InParanoidⁱ	P69795
KEGG Orthology (KO) More...KOⁱ	K02760
OMAⁱ	VFMEKKH
PhylomeDBⁱ	P69795

Family and domain databases

InterProⁱ	View protein in InterPro IPR036095 PTS_EIIB-like_sf IPR003501 PTS_EIIB_2/3 IPR013012 PTS_EIIB_3
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02302 PTS_IIB, 1 hit
SUPFAMⁱ	SSF52794 SSF52794, 1 hit
TIGRFAMsⁱ	TIGR00853 pts-lac, 1 hit
PROSITEⁱ	View protein in PROSITE PS51100 PTS_EIIB_TYPE_3, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P69795-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MEKKHIYLFC SAGMSTSLLV SKMRAQAEKY EVPVIIEAFP ETLAGEKGQN 
        60         70         80         90        100
ADVVLLGPQI AYMLPEIQRL LPNKPVEVID SLLYGKVDGL GVLKAAVAAI 

KKAAAN

Length:106

Mass (Da):11,427

Last modified:May 10, 2005 - v1

Checksum:ⁱDE4AADE300D18F53

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X52890 Genomic DNA Translation: CAA37069.1 U00096 Genomic DNA Translation: AAC74808.1 AP009048 Genomic DNA Translation: BAA15519.1
PIRⁱ	S10870
NCBI Reference Sequences More...RefSeqⁱ	NP_416252.1, NC_000913.3 WP_000412169.1, NZ_LN832404.1

Genome annotation databases

EnsemblBacteriaⁱ	AAC74808; AAC74808; b1738 BAA15519; BAA15519; BAA15519
GeneIDⁱ	945339
KEGGⁱ	ecj:JW1727 eco:b1738
PATRICⁱ	fig\|1411691.4.peg.518

Protein	Similar proteins		Species	Score	Length	Source
P69795	PTS system N,N'-diacetylchitobiose-specific EIIB component		ECO57		106	UniRef100_P69830
PTS system N,N'-diacetylchitobiose-specific EIIB component		ECOL6		106
PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB		ECOLX		130
N,N'-diacetylchitobiose-specific enzyme IIB component of PTS		Escherichia coli NCCP15648		106
PTS system, chitobiose-specific IIB component		Klebsiella pneumoniae IS22		106
+173

Protein	Similar proteins		Species	Score	Length	Source
P69795	PTS system N,N'-diacetylchitobiose-specific EIIB component		ECO57		106	UniRef90_P69830
PTS system N,N'-diacetylchitobiose-specific EIIB component		ECOL6		106
PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB		ECOLX		130
N,N'-diacetylchitobiose-specific enzyme IIB component of PTS		Escherichia coli NCCP15648		106
PTS system, chitobiose-specific IIB component		Klebsiella pneumoniae IS22		106
+189

Protein	Similar proteins		Species	Score	Length	Source
P69795	PTS system N,N'-diacetylchitobiose-specific EIIB component		ECO57		106	UniRef50_P69830
PTS system N,N'-diacetylchitobiose-specific EIIB component		ECOL6		106
PTS system N,N'-diacetylchitobiose-specific transporter subunit IIB		ECOLX		130
N,N'-diacetylchitobiose-specific enzyme IIB component of PTS		Escherichia coli NCCP15648		106
PTS system, chitobiose-specific IIB component		Klebsiella pneumoniae IS22		106
+754

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X52890 Genomic DNA Translation: CAA37069.1 U00096 Genomic DNA Translation: AAC74808.1 AP009048 Genomic DNA Translation: BAA15519.1
PIRⁱ	S10870
RefSeqⁱ	NP_416252.1, NC_000913.3 WP_000412169.1, NZ_LN832404.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1E2B	NMR	-	A	1-106	[»]
	1H9C	NMR	-	A	1-106	[»]
	1IIB	X-ray	1.80	A/B	1-106	[»]
	2WWV	NMR	-	D	3-105	[»]
	2WY2	NMR	-	D	3-105	[»]
ProteinModelPortalⁱ	P69795
SMRⁱ	P69795
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	4260316, 17 interactors
IntActⁱ	P69795, 1 interactor
STRINGⁱ	316385.ECDH10B_1876

Chemistry databases

DrugBankⁱ	DB03544 S-Phosphocysteine

DrugBankⁱ

DB03544 S-Phosphocysteine

Protein family/group databases

TCDBⁱ	4.A.3.2.1 the pts lactose-n,n'-diacetylchitobiose-Beta-glucoside (lac) family

TCDBⁱ

4.A.3.2.1 the pts lactose-n,n'-diacetylchitobiose-Beta-glucoside (lac) family

PTM databases

iPTMnetⁱ	P69795

iPTMnetⁱ

P69795

Proteomic databases

PaxDbⁱ	P69795
PRIDEⁱ	P69795

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAC74808; AAC74808; b1738 BAA15519; BAA15519; BAA15519
GeneIDⁱ	945339
KEGGⁱ	ecj:JW1727 eco:b1738
PATRICⁱ	fig\|1411691.4.peg.518

Organism-specific databases

EchoBASEⁱ	EB0138
EcoGeneⁱ	EG10140 chbB

Phylogenomic databases

eggNOGⁱ	ENOG4105VZJ Bacteria COG1440 LUCA
HOGENOMⁱ	HOG000224223
InParanoidⁱ	P69795
KOⁱ	K02760
OMAⁱ	VFMEKKH
PhylomeDBⁱ	P69795

Enzyme and pathway databases

BioCycⁱ	EcoCyc:CELA-MONOMER MetaCyc:CELA-MONOMER

BioCycⁱ

EcoCyc:CELA-MONOMER
MetaCyc:CELA-MONOMER

Miscellaneous databases

EvolutionaryTraceⁱ	P69795
Protein Ontology More...PROⁱ	PR:P69795

Family and domain databases

InterProⁱ	View protein in InterPro IPR036095 PTS_EIIB-like_sf IPR003501 PTS_EIIB_2/3 IPR013012 PTS_EIIB_3
Pfamⁱ	View protein in Pfam PF02302 PTS_IIB, 1 hit
SUPFAMⁱ	SSF52794 SSF52794, 1 hit
TIGRFAMsⁱ	TIGR00853 pts-lac, 1 hit
PROSITEⁱ	View protein in PROSITE PS51100 PTS_EIIB_TYPE_3, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	PTQB_ECOLI
Accessionⁱ	P69795Primary (citable) accession number: P69795 Secondary accession number(s): P17409
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 10, 2005
	Last sequence update:	May 10, 2005
	Last modified:	March 28, 2018
	This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Escherichia coli
Escherichia coli (strain K12): entries and cross-references to EcoGene

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P69795 (PTQB_ECOLI)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

PTS system N,N'-diacetylchitobiose-specific EIIB component

chbB

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Chemistry databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Protein family/group databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ