UniProtKB - P69488 (CUTA_ECOLI)

BLAST

>sp|P69488|CUTA_ECOLI Divalent-cation tolerance protein CutA OS=Escherichia coli (strain K12) OX=83333 GN=cutA PE=1 SV=1
MLDEKSSNTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEY
EVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR

Align
Format
Add to basket Added to basket
History
Entry version 109 (28 Mar 2018)
Sequence version 1 (15 Mar 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Divalent-cation tolerance protein CutA

Gene

cutA

Organism

Escherichia coli (strain K12)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Involved in resistance toward heavy metals.1 Publication

Cofactorⁱ

Cu cation1 PublicationNote: Binds 1 copper ion per subunit.1 Publication

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	16	CopperCurated	1
Metal bindingⁱ	83	CopperCurated	1
Metal bindingⁱ	84	CopperCurated	1

GO - Molecular functionⁱ

copper ion binding Source: GO_Central
metal ion binding
Source: EcoCyc
Inferred from direct assayⁱ
- 12949080

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

protein homooligomerization
Source: UniProtKB
Inferred from direct assayⁱ
- 12949080
response to copper ion
Source: EcoCyc
Inferred from mutant phenotypeⁱ
- 7623666

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Ligand	Copper, Metal-binding

Ligand

Copper, Metal-binding

Enzyme and pathway databases

BioCycⁱ	EcoCyc:EG12177-MONOMER

BioCycⁱ

EcoCyc:EG12177-MONOMER

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Divalent-cation tolerance protein CutA Alternative name(s): C-type cytochrome biogenesis protein CycY
Gene namesⁱ	Name:cutA Synonyms:cutA1, cycY Ordered Locus Names:b4137, JW4097
Organismⁱ	Escherichia coli (strain K12)
Taxonomic identifierⁱ	83333 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli
Proteomesⁱ	UP000000318 Componentⁱ: Chromosome UP000000625 Componentⁱ: Chromosome

Organism-specific databases

EcoGeneⁱ	EG12177 cutA

EcoGeneⁱ

EG12177 cutA

Subcellular locationⁱ

Cytoplasm
1 Publication
Manual assertion inferred by curator fromⁱ
- Ref.2
  "Molecular genetics of a chromosomal locus involved in copper tolerance in Escherichia coli K-12."
  Fong S.-T., Camakaris J., Lee B.T.O.
  Mol. Microbiol. 15:1127-1137(1995) [PubMed] [Europe PMC] [Abstract]
  Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], FUNCTION, SUBCELLULAR LOCATION.

GO - Cellular componentⁱ

cytoplasm Source: UniProtKB-SubCell

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Chemistry databases

Drug and drug target database More...DrugBankⁱ	DB03975 Mercuribenzoic Acid

DrugBankⁱ

DB03975 Mercuribenzoic Acid

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000157118	1 – 112	Divalent-cation tolerance protein CutAAdd BLAST		112

Proteomic databases

EPDⁱ	P69488
PaxDbⁱ	P69488
PRIDEⁱ	P69488

Interactionⁱ

Subunit structureⁱ

Homotrimer.1 Publication

Protein-protein interaction databases

BioGridⁱ	4262693, 8 interactors
Database of interacting proteins More...DIPⁱ	DIP-47984N
IntActⁱ	P69488, 10 interactors
STRINGⁱ	316385.ECDH10B_4330

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Turnⁱ	4 – 6	Combined sources	3
Beta strandⁱ	11 – 20	Combined sources	10
Helixⁱ	21 – 33	Combined sources	13
Beta strandⁱ	38 – 52	Combined sources	15
Beta strandⁱ	55 – 69	Combined sources	15
Helixⁱ	70 – 72	Combined sources	3
Helixⁱ	73 – 83	Combined sources	11
Beta strandⁱ	85 – 88	Combined sources	4
Beta strandⁱ	91 – 95	Combined sources	5
Helixⁱ	101 – 110	Combined sources	10

Show more details

3D structure databases

ProteinModelPortalⁱ	P69488
SMRⁱ	P69488
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

P69488

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the CutA family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG4105VF7 Bacteria COG1324 LUCA
HOGENOMⁱ	HOG000222826
InParanoidⁱ	P69488
KEGG Orthology (KO) More...KOⁱ	K03926
OMAⁱ	SVYRWQG
PhylomeDBⁱ	P69488

Family and domain databases

Gene3Dⁱ	3.30.70.120, 1 hit
HAMAPⁱ	MF_01160 CutA, 1 hit
InterProⁱ	View protein in InterPro IPR023700 CutA_Enterobact IPR004323 Ion_tolerance_CutA IPR011322 N-reg_PII-like_a/b IPR015867 N-reg_PII/ATP_PRibTrfase_C
PANTHERⁱ	PTHR23419 PTHR23419, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF03091 CutA1, 1 hit
SUPFAMⁱ	SSF54913 SSF54913, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P69488-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLDEKSSNTA SVVVLCTAPD EATAQDLAAK VLAEKLAACA TLIPGATSLY 
        60         70         80         90        100
YWEGKLEQEY EVQMILKTTV SHQQALLECL KSHHPYQTPE LLVLPVTHGD 
       110 
TDYLSWLNAS LR

Length:112

Mass (Da):12,331

Last modified:March 15, 2005 - v1

Checksum:ⁱ802145EF012DDB69

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	24	A → R (PubMed:7623667).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X77707 Genomic DNA Translation: CAA54780.1 Z36905 Genomic DNA Translation: CAA85374.1 U14003 Genomic DNA Translation: AAA97036.1 U00096 Genomic DNA Translation: AAC77097.1 AP009048 Genomic DNA Translation: BAE78139.1
PIRⁱ	I41027
NCBI Reference Sequences More...RefSeqⁱ	NP_418560.1, NC_000913.3 WP_000883400.1, NZ_LN832404.1

Genome annotation databases

EnsemblBacteriaⁱ	AAC77097; AAC77097; b4137 BAE78139; BAE78139; BAE78139
GeneIDⁱ	948660
KEGGⁱ	ecj:JW4097 eco:b4137
PATRICⁱ	fig\|1411691.4.peg.2563

Protein	Similar proteins		Species	Score	Length	Source
P69488	Divalent-cation tolerance protein CutA		ECO24		112	UniRef100_A7ZV06
Divalent-cation tolerance protein CutA		ECO55		112
Divalent-cation tolerance protein CutA		ECO57		112
Divalent-cation tolerance protein CutA		ECO5E		112
Divalent-cation tolerance protein CutA		ECO7I		112
+143

Protein	Similar proteins		Species	Score	Length	Source
P69488	Divalent-cation tolerance protein CutA		CITK8		115	UniRef90_A8AMR3
Divalent-cation tolerance protein CutA		SALA4		115
Divalent-cation tolerance protein CutA		SALCH		115
Divalent-cation tolerance protein CutA		SALDC		115
Divalent-cation tolerance protein CutA		SALEP		115
+434

Protein	Similar proteins		Species	Score	Length	Source
P69488	Divalent-cation tolerance protein CutA		CITK8		115	UniRef50_A8AMR3
Divalent-cation tolerance protein CutA		SALA4		115
Divalent-cation tolerance protein CutA		SALCH		115
Divalent-cation tolerance protein CutA		SALDC		115
Divalent-cation tolerance protein CutA		SALEP		115
+658

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X77707 Genomic DNA Translation: CAA54780.1 Z36905 Genomic DNA Translation: CAA85374.1 U14003 Genomic DNA Translation: AAA97036.1 U00096 Genomic DNA Translation: AAC77097.1 AP009048 Genomic DNA Translation: BAE78139.1
PIRⁱ	I41027
RefSeqⁱ	NP_418560.1, NC_000913.3 WP_000883400.1, NZ_LN832404.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1NAQ	X-ray	1.70	A/B/C/D/E/F	1-112	[»]
	3AA8	X-ray	2.30	A/B/C	1-112	[»]
	3AA9	X-ray	2.30	A/B/C	1-112	[»]
	3AH6	X-ray	2.40	A/B/C/D/E/F	1-112	[»]
	3X3U	X-ray	2.09	A/B/C/D/E/F	1-112	[»]
	4Y65	X-ray	1.70	A/B/C	1-112	[»]
	4Y6I	X-ray	1.70	A/B/C/D/E/F	5-112	[»]
ProteinModelPortalⁱ	P69488
SMRⁱ	P69488
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	4262693, 8 interactors
DIPⁱ	DIP-47984N
IntActⁱ	P69488, 10 interactors
STRINGⁱ	316385.ECDH10B_4330

Chemistry databases

DrugBankⁱ	DB03975 Mercuribenzoic Acid

DrugBankⁱ

DB03975 Mercuribenzoic Acid

Proteomic databases

EPDⁱ	P69488
PaxDbⁱ	P69488
PRIDEⁱ	P69488

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAC77097; AAC77097; b4137 BAE78139; BAE78139; BAE78139
GeneIDⁱ	948660
KEGGⁱ	ecj:JW4097 eco:b4137
PATRICⁱ	fig\|1411691.4.peg.2563

Organism-specific databases

EchoBASEⁱ	EB2094
EcoGeneⁱ	EG12177 cutA

Phylogenomic databases

eggNOGⁱ	ENOG4105VF7 Bacteria COG1324 LUCA
HOGENOMⁱ	HOG000222826
InParanoidⁱ	P69488
KOⁱ	K03926
OMAⁱ	SVYRWQG
PhylomeDBⁱ	P69488

Enzyme and pathway databases

BioCycⁱ	EcoCyc:EG12177-MONOMER

BioCycⁱ

EcoCyc:EG12177-MONOMER

Miscellaneous databases

EvolutionaryTraceⁱ	P69488
Protein Ontology More...PROⁱ	PR:P69488

Family and domain databases

Gene3Dⁱ	3.30.70.120, 1 hit
HAMAPⁱ	MF_01160 CutA, 1 hit
InterProⁱ	View protein in InterPro IPR023700 CutA_Enterobact IPR004323 Ion_tolerance_CutA IPR011322 N-reg_PII-like_a/b IPR015867 N-reg_PII/ATP_PRibTrfase_C
PANTHERⁱ	PTHR23419 PTHR23419, 1 hit
Pfamⁱ	View protein in Pfam PF03091 CutA1, 1 hit
SUPFAMⁱ	SSF54913 SSF54913, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	CUTA_ECOLI
Accessionⁱ	P69488Primary (citable) accession number: P69488 Secondary accession number(s): P36654, Q2M6G7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 15, 2005
	Last sequence update:	March 15, 2005
	Last modified:	March 28, 2018
	This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P69488 (CUTA_ECOLI)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Divalent-cation tolerance protein CutA

cutA

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ