Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Peptidyl-prolyl cis-trans isomerase FKBP1B

Gene

FKBP1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has the potential to contribute to the immunosuppressive and toxic effects of FK506 and rapamycin. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by both FK506 and rapamycin.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIsomerase, Rotamase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351 Stimuli-sensing channels
R-HSA-5578775 Ion homeostasis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Peptidyl-prolyl cis-trans isomerase FKBP1B (EC:5.2.1.8)
Short name:
PPIase FKBP1B
Alternative name(s):
12.6 kDa FK506-binding protein
Short name:
12.6 kDa FKBP
Short name:
FKBP-12.6
FK506-binding protein 1B
Short name:
FKBP-1B
Immunophilin FKBP12.6
Rotamase
h-FKBP-12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FKBP1B
Synonyms:FKBP12.6, FKBP1L, FKBP9, OTK4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000119782.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3712 FKBP1B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600620 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P68106

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Sarcoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
2281

Open Targets

More...
OpenTargetsi
ENSG00000119782

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA28154

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2430

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FKBP1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
61224185

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000752951 – 108Peptidyl-prolyl cis-trans isomerase FKBP1BAdd BLAST108

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P68106

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P68106

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P68106

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P68106

PeptideAtlas

More...
PeptideAtlasi
P68106

PRoteomics IDEntifications database

More...
PRIDEi
P68106

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57530
57531 [P68106-2]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P68106

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in heart muscle (at protein level). Isoform 1 and isoform 2 are ubiquitous with highest levels in brain and thymus.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000119782 Expressed in 88 organ(s), highest expression level in caudate nucleus

CleanEx database of gene expression profiles

More...
CleanExi
HS_FKBP1B
HS_FKBP9

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P68106 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P68106 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045572
HPA051798

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Identified in a complex composed of RYR2, FKBP1B, PKA catalytic subunit, PRKAR2A, AKAP6, and the protein phosphatases PP2A and PP1. Interacts directly with RYR2.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108571, 30 interactors

Database of interacting proteins

More...
DIPi
DIP-48796N

Protein interaction database and analysis system

More...
IntActi
P68106, 14 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000370373

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P68106

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1108
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1C9HX-ray2.00A2-108[»]
4C02X-ray2.17B1-108[»]
4IQ2X-ray1.70A/B2-108[»]
4IQCX-ray1.90A/B2-108[»]
5HKGX-ray1.50A2-108[»]
5L1Delectron microscopy10.50B/D/F/H2-108[»]
5T15electron microscopy3.80A/F/H/J1-108[»]
5T9Melectron microscopy3.80A/F/H/J1-108[»]
5T9Nelectron microscopy3.80A/F/H/J1-108[»]
5T9Relectron microscopy3.80A/F/H/J1-108[»]
5T9Selectron microscopy3.80A/F/H/J1-108[»]
5T9Velectron microscopy3.80A/F/H/J1-108[»]
5TA3electron microscopy3.80A/F/H/J1-108[»]
5TALelectron microscopy3.80A/F/H/J1-108[»]
5TAMelectron microscopy3.80A/F/H/J1-108[»]
5TANelectron microscopy3.80A/F/H/J1-108[»]
5TAPelectron microscopy3.80A/F/H/J1-108[»]
5TAQelectron microscopy3.80A/F/H/J1-108[»]
5TASelectron microscopy3.80A/F/H/J1-108[»]
5TATelectron microscopy3.80A/F/H/J1-108[»]
5TAUelectron microscopy3.80A/F/H/J1-108[»]
5TAVelectron microscopy3.80A/F/H/J1-108[»]
5TAWelectron microscopy3.80A/F/H/J1-108[»]
5TAXelectron microscopy3.80A/F/H/J1-108[»]
5TAYelectron microscopy3.80A/F/H/J1-108[»]
5TAZelectron microscopy3.80A/F/H/J1-108[»]
5TB0electron microscopy4.40A/F/H/J1-108[»]
5TB1electron microscopy3.80A/F/H/J1-108[»]
5TB2electron microscopy3.80A/F/H/J1-108[»]
5TB3electron microscopy3.80A/F/H/J1-108[»]
5TB4electron microscopy3.80A/F/H/J1-108[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P68106

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P68106

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P68106

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 108PPIase FKBP-typePROSITE-ProRule annotationAdd BLAST89

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0544 Eukaryota
COG0545 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153311

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154887

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051623

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P68106

KEGG Orthology (KO)

More...
KOi
K09568

Identification of Orthologs from Complete Genome Data

More...
OMAi
QLIRGWD

Database of Orthologous Groups

More...
OrthoDBi
435947at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P68106

TreeFam database of animal gene trees

More...
TreeFami
TF105291

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10516 PTHR10516, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00254 FKBP_C, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50059 FKBP_PPIASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P68106-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGVEIETISP GDGRTFPKKG QTCVVHYTGM LQNGKKFDSS RDRNKPFKFR
60 70 80 90 100
IGKQEVIKGF EEGAAQMSLG QRAKLTCTPD VAYGATGHPG VIPPNATLIF

DVELLNLE
Length:108
Mass (Da):11,783
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBAC2A25945F63AC4
GO
Isoform 2 (identifier: P68106-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-108: MSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE → LGPLSPLPICPHPC

Show »
Length:80
Mass (Da):8,802
Checksum:i99C0A9C743984BA2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W6G9F8W6G9_HUMAN
Peptidylprolyl isomerase
FKBP1B
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G5E9U6G5E9U6_HUMAN
FK506 binding protein 1B, 12.6 kDa,...
FKBP1B hCG_20938
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0Y3H7C0Y3_HUMAN
Peptidyl-prolyl cis-trans isomerase...
FKBP1B
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00518467 – 108MSLGQ…LLNLE → LGPLSPLPICPHPC in isoform 2. 3 PublicationsAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
S69815 mRNA Translation: AAB30684.1
D38037 mRNA Translation: BAA07232.1
L37086 mRNA Translation: AAC37581.1
S69800 mRNA Translation: AAB30685.1
AF322070 mRNA Translation: AAK11191.1
AB190793 Genomic DNA Translation: BAE44300.1
AC008073 Genomic DNA Translation: AAY14663.1
CH471053 Genomic DNA Translation: EAX00769.1
BC002614 mRNA Translation: AAH02614.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1706.1
CCDS33153.1 [P68106-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC2188

NCBI Reference Sequences

More...
RefSeqi
NP_004107.1, NM_004116.4 [P68106-1]
NP_473374.1, NM_054033.3 [P68106-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.709461

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380986; ENSP00000370373; ENSG00000119782 [P68106-1]
ENST00000380991; ENSP00000370379; ENSG00000119782 [P68106-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2281

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2281

UCSC genome browser

More...
UCSCi
uc002rer.4 human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S69815 mRNA Translation: AAB30684.1
D38037 mRNA Translation: BAA07232.1
L37086 mRNA Translation: AAC37581.1
S69800 mRNA Translation: AAB30685.1
AF322070 mRNA Translation: AAK11191.1
AB190793 Genomic DNA Translation: BAE44300.1
AC008073 Genomic DNA Translation: AAY14663.1
CH471053 Genomic DNA Translation: EAX00769.1
BC002614 mRNA Translation: AAH02614.1
CCDSiCCDS1706.1
CCDS33153.1 [P68106-2]
PIRiJC2188
RefSeqiNP_004107.1, NM_004116.4 [P68106-1]
NP_473374.1, NM_054033.3 [P68106-2]
UniGeneiHs.709461

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1C9HX-ray2.00A2-108[»]
4C02X-ray2.17B1-108[»]
4IQ2X-ray1.70A/B2-108[»]
4IQCX-ray1.90A/B2-108[»]
5HKGX-ray1.50A2-108[»]
5L1Delectron microscopy10.50B/D/F/H2-108[»]
5T15electron microscopy3.80A/F/H/J1-108[»]
5T9Melectron microscopy3.80A/F/H/J1-108[»]
5T9Nelectron microscopy3.80A/F/H/J1-108[»]
5T9Relectron microscopy3.80A/F/H/J1-108[»]
5T9Selectron microscopy3.80A/F/H/J1-108[»]
5T9Velectron microscopy3.80A/F/H/J1-108[»]
5TA3electron microscopy3.80A/F/H/J1-108[»]
5TALelectron microscopy3.80A/F/H/J1-108[»]
5TAMelectron microscopy3.80A/F/H/J1-108[»]
5TANelectron microscopy3.80A/F/H/J1-108[»]
5TAPelectron microscopy3.80A/F/H/J1-108[»]
5TAQelectron microscopy3.80A/F/H/J1-108[»]
5TASelectron microscopy3.80A/F/H/J1-108[»]
5TATelectron microscopy3.80A/F/H/J1-108[»]
5TAUelectron microscopy3.80A/F/H/J1-108[»]
5TAVelectron microscopy3.80A/F/H/J1-108[»]
5TAWelectron microscopy3.80A/F/H/J1-108[»]
5TAXelectron microscopy3.80A/F/H/J1-108[»]
5TAYelectron microscopy3.80A/F/H/J1-108[»]
5TAZelectron microscopy3.80A/F/H/J1-108[»]
5TB0electron microscopy4.40A/F/H/J1-108[»]
5TB1electron microscopy3.80A/F/H/J1-108[»]
5TB2electron microscopy3.80A/F/H/J1-108[»]
5TB3electron microscopy3.80A/F/H/J1-108[»]
5TB4electron microscopy3.80A/F/H/J1-108[»]
ProteinModelPortaliP68106
SMRiP68106
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108571, 30 interactors
DIPiDIP-48796N
IntActiP68106, 14 interactors
STRINGi9606.ENSP00000370373

Chemistry databases

BindingDBiP68106
ChEMBLiCHEMBL2430

PTM databases

PhosphoSitePlusiP68106

Polymorphism and mutation databases

BioMutaiFKBP1B
DMDMi61224185

Proteomic databases

EPDiP68106
jPOSTiP68106
MaxQBiP68106
PaxDbiP68106
PeptideAtlasiP68106
PRIDEiP68106
ProteomicsDBi57530
57531 [P68106-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
2281
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380986; ENSP00000370373; ENSG00000119782 [P68106-1]
ENST00000380991; ENSP00000370379; ENSG00000119782 [P68106-2]
GeneIDi2281
KEGGihsa:2281
UCSCiuc002rer.4 human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
2281
DisGeNETi2281
EuPathDBiHostDB:ENSG00000119782.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FKBP1B
HGNCiHGNC:3712 FKBP1B
HPAiHPA045572
HPA051798
MIMi600620 gene
neXtProtiNX_P68106
OpenTargetsiENSG00000119782
PharmGKBiPA28154

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0544 Eukaryota
COG0545 LUCA
GeneTreeiENSGT00940000153311
HOGENOMiHOG000154887
HOVERGENiHBG051623
InParanoidiP68106
KOiK09568
OMAiQLIRGWD
OrthoDBi435947at2759
PhylomeDBiP68106
TreeFamiTF105291

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels
R-HSA-5578775 Ion homeostasis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FKBP1B human
EvolutionaryTraceiP68106

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FKBP1B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
2281

Protein Ontology

More...
PROi
PR:P68106

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000119782 Expressed in 88 organ(s), highest expression level in caudate nucleus
CleanExiHS_FKBP1B
HS_FKBP9
ExpressionAtlasiP68106 baseline and differential
GenevisibleiP68106 HS

Family and domain databases

InterProiView protein in InterPro
IPR023566 PPIase_FKBP
IPR001179 PPIase_FKBP_dom
PANTHERiPTHR10516 PTHR10516, 1 hit
PfamiView protein in Pfam
PF00254 FKBP_C, 1 hit
PROSITEiView protein in PROSITE
PS50059 FKBP_PPIASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFKB1B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P68106
Secondary accession number(s): Q13664
, Q16645, Q53TM2, Q9BQ40
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2004
Last sequence update: January 23, 2007
Last modified: January 16, 2019
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again