UniProtKB - P68082 (MYG_HORSE)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P68082|MYG_HORSE Myoglobin OS=Equus caballus OX=9796 GN=MB PE=1 SV=2 MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH PGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Myoglobin
MB
Annotation score:3 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Sites
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi | 65 | Iron (heme distal ligand)1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi | 94 | Iron (heme proximal ligand)Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- heme binding Source: InterPro
- metal ion binding Source: UniProtKB-KW
- oxygen binding Source: InterPro
- oxygen carrier activity Source: UniProtKB-KW
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Muscle protein |
| Biological process | Oxygen transport, Transport |
| Ligand | Heme, Iron, Metal-binding |
Enzyme and pathway databases
SABIO-RK: Biochemical Reaction Kinetics Database More...SABIO-RKi | P68082 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Myoglobin |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:MB |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Equus caballus (Horse) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9796 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Laurasiatheria › Perissodactyla › Equidae › Equus › Equus |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Vertebrate Gene Nomenclature Database More...VGNCi | VGNC:20004 MB |
<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Protein family/group databases
Allergome; a platform for allergen knowledge More...Allergomei | 10877 Equ c Myoglobin |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | Removed3 Publications <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000053302 | 2 – 154 | MyoglobinAdd BLAST | 153 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 4 | PhosphoserineBy similarity <p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi | 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
PhosphoproteinProteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P68082 |
PRoteomics IDEntifications database More...PRIDEi | P68082 |
PTM databases
CarbonylDB database of protein carbonylation sites More...CarbonylDBi | P68082 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
Protein-protein interaction databases
STRING: functional protein association networks More...STRINGi | 9796.ENSECAP00000015509 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 5 – 19 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 15 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 22 – 36 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 15 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 38 – 41 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 45 – 47 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 53 – 58 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 60 – 96 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 37 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 102 – 119 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 18 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 121 – 123 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 126 – 149 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 24 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 150 – 153 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P68082 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P68082 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P68082 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
<p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG3378 Eukaryota COG1018 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00730000110844 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000070111 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG107340 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P68082 |
KEGG Orthology (KO) More...KOi | K21892 |
Identification of Orthologs from Complete Genome Data More...OMAi | LFRNDIA |
Database of Orthologous Groups More...OrthoDBi | EOG091G0OAO |
TreeFam database of animal gene trees More...TreeFami | TF332967 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 1.10.490.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR000971 Globin IPR009050 Globin-like_sf IPR012292 Globin/Proto IPR002335 Myoglobin |
The PANTHER Classification System More...PANTHERi | PTHR11442:SF5 PTHR11442:SF5, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00042 Globin, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00613 MYOGLOBIN |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF46458 SSF46458, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01033 GLOBIN, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
10 20 30 40 50
MGLSDGEWQQ VLNVWGKVEA DIAGHGQEVL IRLFTGHPET LEKFDKFKHL
60 70 80 90 100
KTEAEMKASE DLKKHGTVVL TALGGILKKK GHHEAELKPL AQSHATKHKI
110 120 130 140 150
PIKYLEFISD AIIHVLHSKH PGDFGADAQG AMTKALELFR NDIAAKYKEL
GFQG
Experimental Info
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti | 123 | D → N AA sequence (PubMed:4902609).Curated | 1 |
Sequence databases
Protein sequence database of the Protein Information Resource More...PIRi | A91098 MYHO |
NCBI Reference Sequences More...RefSeqi | NP_001157488.1, NM_001164016.1 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Eca.16922 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENSECAT00000018976; ENSECAP00000015509; ENSECAG00000017982 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 100054434 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | ecb:100054434 |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P68082 | Myoglobin | 154 | |||
| UPI00001106E5 | 153 | ||||
| UPI00071A40AD | 195 | ||||
| UPI0002AB7F2D | 152 |
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P68082 | Myoglobin | 154 | |||
| UPI00001106E5 | 153 | ||||
| UPI00071A40AD | 195 | ||||
| UPI0002AB7F2D | 152 |
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P68082 | Myoglobin | ) | 154 | ||
| Myoglobin (Fragment) | 106 | ||||
| UPI000C2AAD7E | 192 | ||||
| UPI000CEFDAE9 | 166 | ||||
| UPI000C87A79B | 163 | ||||
| +92 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
Protein sequence database of the Protein Information Resource More...PIRi | A91098 MYHO |
NCBI Reference Sequences More...RefSeqi | NP_001157488.1, NM_001164016.1 |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Eca.16922 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1AZI | X-ray | 2.00 | A | 2-154 | [»] | |
| 1BJE | X-ray | 1.80 | A | 2-154 | [»] | |
| 1DWR | X-ray | 1.45 | A | 2-154 | [»] | |
| 1DWS | X-ray | 1.45 | A | 2-154 | [»] | |
| 1DWT | X-ray | 1.40 | A | 2-154 | [»] | |
| 1GJN | X-ray | 1.35 | A | 2-154 | [»] | |
| 1HRM | X-ray | 1.70 | A | 2-154 | [»] | |
| 1HSY | X-ray | 1.90 | A | 2-154 | [»] | |
| 1NPF | X-ray | 1.90 | A | 2-154 | [»] | |
| 1NPG | X-ray | 1.70 | A | 2-154 | [»] | |
| 1NZ2 | X-ray | 1.90 | A | 2-154 | [»] | |
| 1NZ3 | X-ray | 1.60 | A | 2-154 | [»] | |
| 1NZ4 | X-ray | 1.80 | A | 2-154 | [»] | |
| 1NZ5 | X-ray | 1.70 | A | 2-154 | [»] | |
| 1RSE | X-ray | 1.70 | A | 2-154 | [»] | |
| 1WLA | X-ray | 1.70 | A | 2-154 | [»] | |
| 1XCH | X-ray | 1.70 | A | 2-154 | [»] | |
| 1YMA | X-ray | 2.00 | A | 2-154 | [»] | |
| 1YMB | X-ray | 1.90 | A | 2-154 | [»] | |
| 1YMC | X-ray | 2.00 | A | 2-154 | [»] | |
| 2FRF | X-ray | 1.20 | A | 2-154 | [»] | |
| 2FRI | X-ray | 1.60 | X | 2-154 | [»] | |
| 2FRJ | X-ray | 1.30 | X | 2-154 | [»] | |
| 2FRK | X-ray | 1.30 | X | 2-154 | [»] | |
| 2IN4 | X-ray | 2.15 | A | 2-154 | [»] | |
| 2NSR | X-ray | 1.90 | A | 2-154 | [»] | |
| 2NSS | X-ray | 2.00 | A | 2-154 | [»] | |
| 2O58 | X-ray | 1.65 | X | 2-154 | [»] | |
| 2O5B | X-ray | 2.00 | X | 2-154 | [»] | |
| 2O5L | X-ray | 1.70 | X | 2-154 | [»] | |
| 2O5M | X-ray | 1.65 | X | 2-154 | [»] | |
| 2O5O | X-ray | 1.60 | X | 2-154 | [»] | |
| 2O5Q | X-ray | 1.90 | X | 2-154 | [»] | |
| 2O5S | X-ray | 1.60 | X | 2-154 | [»] | |
| 2O5T | X-ray | 1.60 | X | 2-154 | [»] | |
| 2V1E | X-ray | 1.30 | A | 2-154 | [»] | |
| 2V1F | X-ray | 1.20 | A | 2-154 | [»] | |
| 2V1G | X-ray | 1.35 | A | 2-154 | [»] | |
| 2V1H | X-ray | 1.30 | A | 2-154 | [»] | |
| 2V1I | X-ray | 1.20 | A | 2-154 | [»] | |
| 2V1J | X-ray | 1.40 | A | 2-154 | [»] | |
| 2V1K | X-ray | 1.25 | A | 2-154 | [»] | |
| 2VLX | X-ray | 1.30 | A | 2-154 | [»] | |
| 2VLY | X-ray | 1.60 | A | 2-154 | [»] | |
| 2VLZ | X-ray | 1.50 | A | 2-154 | [»] | |
| 2VM0 | X-ray | 1.60 | A | 2-154 | [»] | |
| 3BA2 | X-ray | 1.80 | A | 2-154 | [»] | |
| 3HC9 | X-ray | 2.00 | A | 2-154 | [»] | |
| 3HEN | X-ray | 1.90 | A | 2-154 | [»] | |
| 3HEO | X-ray | 2.00 | A | 2-154 | [»] | |
| 3HEP | X-ray | 1.95 | A | 2-154 | [»] | |
| 3LR7 | X-ray | 1.60 | A | 2-154 | [»] | |
| 3LR9 | X-ray | 1.55 | A | 2-154 | [»] | |
| 3RJ6 | X-ray | 1.23 | A/B | 2-154 | [»] | |
| 3RJN | X-ray | 1.90 | B | 2-154 | [»] | |
| 3V2V | X-ray | 1.65 | A | 2-154 | [»] | |
| 3V2Z | X-ray | 1.65 | A | 2-154 | [»] | |
| 3VAU | X-ray | 1.70 | A | 2-154 | [»] | |
| 3VM9 | X-ray | 1.05 | A/B | 2-154 | [»] | |
| 3WFT | X-ray | 1.30 | A | 2-154 | [»] | |
| 3WFU | X-ray | 1.35 | A | 2-154 | [»] | |
| 3WI8 | X-ray | 2.20 | A | 2-154 | [»] | |
| 3WYO | X-ray | 2.00 | A/B/C/D | 2-154 | [»] | |
| 4DC7 | X-ray | 1.50 | A | 2-153 | [»] | |
| 4DC8 | X-ray | 1.50 | A | 2-153 | [»] | |
| 4NS2 | X-ray | 1.18 | A | 1-154 | [»] | |
| 4TWU | X-ray | 1.08 | A | 1-154 | [»] | |
| 4TWV | X-ray | 1.06 | A | 1-154 | [»] | |
| 5AZQ | X-ray | 1.40 | A | 2-154 | [»] | |
| 5AZR | X-ray | 1.20 | A | 2-154 | [»] | |
| 5CMV | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CN4 | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CN5 | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CN6 | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CN7 | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CN8 | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CN9 | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CNB | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CNC | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CND | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CNE | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CNF | X-ray | 1.80 | A | 2-153 | [»] | |
| 5CNG | X-ray | 1.80 | A | 2-153 | [»] | |
| 5D5R | X-ray | 1.60 | A | 2-153 | [»] | |
| 5YL3 | X-ray | 1.50 | A | 1-154 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P68082 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P68082 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
STRING: functional protein association networks More...STRINGi | 9796.ENSECAP00000015509 |
Protein family/group databases
Allergome; a platform for allergen knowledge More...Allergomei | 10877 Equ c Myoglobin |
PTM databases
CarbonylDB database of protein carbonylation sites More...CarbonylDBi | P68082 |
Proteomic databases
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P68082 |
PRoteomics IDEntifications database More...PRIDEi | P68082 |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENSECAT00000018976; ENSECAP00000015509; ENSECAG00000017982 |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 100054434 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | ecb:100054434 |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 4151 |
Vertebrate Gene Nomenclature Database More...VGNCi | VGNC:20004 MB |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG3378 Eukaryota COG1018 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00730000110844 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000070111 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG107340 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P68082 |
KEGG Orthology (KO) More...KOi | K21892 |
Identification of Orthologs from Complete Genome Data More...OMAi | LFRNDIA |
Database of Orthologous Groups More...OrthoDBi | EOG091G0OAO |
TreeFam database of animal gene trees More...TreeFami | TF332967 |
Enzyme and pathway databases
SABIO-RK: Biochemical Reaction Kinetics Database More...SABIO-RKi | P68082 |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P68082 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 1.10.490.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR000971 Globin IPR009050 Globin-like_sf IPR012292 Globin/Proto IPR002335 Myoglobin |
The PANTHER Classification System More...PANTHERi | PTHR11442:SF5 PTHR11442:SF5, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00042 Globin, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00613 MYOGLOBIN |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF46458 SSF46458, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS01033 GLOBIN, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | MYG_HORSE | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P68082Primary (citable) accession number: P68082 Secondary accession number(s): P02188 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | July 21, 1986 |
| Last sequence update: | January 23, 2007 | |
| Last modified: | April 25, 2018 | |
| This is version 104 of the entry and version 2 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- PDB cross-references
Index of Protein Data Bank (PDB) cross-references - SIMILARITY comments
Index of protein domains and families
