Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (18 Sep 2019)
Sequence version 1 (11 Oct 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Signal peptidase complex catalytic subunit SEC11A

Gene

SEC11A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins. EC:3.4.21.89

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei56By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane
R-HSA-381771 Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
R-HSA-400511 Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S26.009

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Signal peptidase complex catalytic subunit SEC11A (EC:3.4.21.89)
Alternative name(s):
Endopeptidase SP18
Microsomal signal peptidase 18 kDa subunit
Short name:
SPase 18 kDa subunit
SEC11 homolog A
SEC11-like protein 1
SPC18
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEC11A
Synonyms:SEC11L1, SPC18, SPCS4A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17718 SEC11A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618258 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P67812

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 16CytoplasmicSequence analysisAdd BLAST16
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei17 – 36Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST20
Topological domaini37 – 179LumenalSequence analysisAdd BLAST143

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
23478

Open Targets

More...
OpenTargetsi
ENSG00000140612

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162402586

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SEC11A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
54039634

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001095431 – 179Signal peptidase complex catalytic subunit SEC11AAdd BLAST179

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P67812

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P67812

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P67812

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P67812

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P67812

PeptideAtlas

More...
PeptideAtlasi
P67812

PRoteomics IDEntifications database

More...
PRIDEi
P67812

ProteomicsDB human proteome resource

More...
ProteomicsDBi
39571
39580
5197
57523 [P67812-1]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P67812-1 [P67812-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P67812

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P67812

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P67812

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140612 Expressed in 235 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P67812 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P67812 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA047533

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the microsomal signal peptidase complex which consists of five members: SEC11A, SEC11C, SPCS1, SPCS2 and SPCS3.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117037, 23 interactors

Database of interacting proteins

More...
DIPi
DIP-50359N

Protein interaction database and analysis system

More...
IntActi
P67812, 21 interactors

Molecular INTeraction database

More...
MINTi
P67812

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000452697

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P67812

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase S26B family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3342 Eukaryota
COG0681 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015600

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111516

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P67812

KEGG Orthology (KO)

More...
KOi
K13280

Identification of Orthologs from Complete Genome Data

More...
OMAi
MMWKGLG

Database of Orthologous Groups

More...
OrthoDBi
1486616at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P67812

TreeFam database of animal gene trees

More...
TreeFami
TF313648

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036286 LexA/Signal_pep-like_sf
IPR019758 Pept_S26A_signal_pept_1_CS
IPR019756 Pept_S26A_signal_pept_1_Ser-AS
IPR015927 Peptidase_S24_S26A/B/C
IPR001733 Peptidase_S26B
IPR037712 SEC11A

The PANTHER Classification System

More...
PANTHERi
PTHR10806 PTHR10806, 1 hit
PTHR10806:SF18 PTHR10806:SF18, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00717 Peptidase_S24, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00728 SIGNALPTASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51306 SSF51306, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02228 sigpep_I_arch, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00501 SPASE_I_1, 1 hit
PS00761 SPASE_I_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P67812-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLSLDFLDDV RRMNKRQLYY QVLNFGMIVS SALMIWKGLM VITGSESPIV
60 70 80 90 100
VVLSGSMEPA FHRGDLLFLT NRVEDPIRVG EIVVFRIEGR EIPIVHRVLK
110 120 130 140 150
IHEKQNGHIK FLTKGDNNAV DDRGLYKQGQ HWLEKKDVVG RARGFVPYIG
160 170
IVTILMNDYP KFKYAVLFLL GLFVLVHRE
Length:179
Mass (Da):20,625
Last modified:October 11, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDFD245A17BA3B47F
GO
Isoform 2 (identifier: P67812-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.

Note: No experimental confirmation available.
Show »
Length:153
Mass (Da):17,408
Checksum:i979DF889F3389CEF
GO
Isoform 3 (identifier: P67812-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-179: FVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE → MQFSFCWVYS...YWMFGVDTGL

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:185
Mass (Da):21,454
Checksum:i00D5E145C05166FA
GO
Isoform 4 (identifier: P67812-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-164: VPYIGIVTILMNDYPKFKY → YQENSSVEDRNYLFLILEL
     165-179: Missing.

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:164
Mass (Da):18,988
Checksum:iFAF0D04553B05F8E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YNG3H0YNG3_HUMAN
Signal peptidase complex catalytic ...
SEC11A
163Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YNX5H0YNX5_HUMAN
Signal peptidase complex catalytic ...
SEC11A
106Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YNA5H0YNA5_HUMAN
Signal peptidase I
SEC11A
135Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YKT4H0YKT4_HUMAN
Signal peptidase complex catalytic ...
SEC11A
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti19Y → C in AAD19640 (Ref. 1) Curated1
Sequence conflicti19Y → C in AAC36354 (PubMed:15489334).Curated1
Sequence conflicti42I → T in BAD96944 (Ref. 4) Curated1
Sequence conflicti163K → R in AAD19640 (Ref. 1) Curated1
Sequence conflicti163K → R in AAC36354 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0550521 – 26Missing in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_055053145 – 179FVPYI…LVHRE → MQFSFCWVYSCWFIVSKKPA LLFLGRCHSFRYWMFGVDTG L in isoform 3. CuratedAdd BLAST35
Alternative sequenceiVSP_055054146 – 164VPYIG…PKFKY → YQENSSVEDRNYLFLILEL in isoform 4. CuratedAdd BLAST19
Alternative sequenceiVSP_055055165 – 179Missing in isoform 4. CuratedAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF108945 mRNA Translation: AAD19640.1
AF061737 mRNA Translation: AAD17526.1
AK300693 mRNA Translation: BAG62376.1
AK314146 mRNA Translation: BAG36834.1
AK223224 mRNA Translation: BAD96944.1
AC087732 Genomic DNA No translation available.
AC115102 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX01952.1
CH471101 Genomic DNA Translation: EAX01954.1
CH471101 Genomic DNA Translation: EAX01956.1
BC000359 mRNA Translation: AAH00359.3
BC014508 mRNA Translation: AAH14508.1
AF090315 mRNA Translation: AAC36354.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45340.1 [P67812-1]
CCDS61742.1 [P67812-2]
CCDS61743.1 [P67812-3]
CCDS61744.1 [P67812-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001258847.1, NM_001271918.1 [P67812-2]
NP_001258848.1, NM_001271919.1
NP_001258849.1, NM_001271920.1 [P67812-4]
NP_001258850.1, NM_001271921.1
NP_001258851.1, NM_001271922.1 [P67812-3]
NP_055115.1, NM_014300.3 [P67812-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000268220; ENSP00000268220; ENSG00000140612 [P67812-1]
ENST00000455959; ENSP00000413121; ENSG00000140612 [P67812-2]
ENST00000558134; ENSP00000452697; ENSG00000140612 [P67812-3]
ENST00000560266; ENSP00000452684; ENSG00000140612 [P67812-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23478

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23478

UCSC genome browser

More...
UCSCi
uc002blb.3 human [P67812-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF108945 mRNA Translation: AAD19640.1
AF061737 mRNA Translation: AAD17526.1
AK300693 mRNA Translation: BAG62376.1
AK314146 mRNA Translation: BAG36834.1
AK223224 mRNA Translation: BAD96944.1
AC087732 Genomic DNA No translation available.
AC115102 Genomic DNA No translation available.
CH471101 Genomic DNA Translation: EAX01952.1
CH471101 Genomic DNA Translation: EAX01954.1
CH471101 Genomic DNA Translation: EAX01956.1
BC000359 mRNA Translation: AAH00359.3
BC014508 mRNA Translation: AAH14508.1
AF090315 mRNA Translation: AAC36354.1
CCDSiCCDS45340.1 [P67812-1]
CCDS61742.1 [P67812-2]
CCDS61743.1 [P67812-3]
CCDS61744.1 [P67812-4]
RefSeqiNP_001258847.1, NM_001271918.1 [P67812-2]
NP_001258848.1, NM_001271919.1
NP_001258849.1, NM_001271920.1 [P67812-4]
NP_001258850.1, NM_001271921.1
NP_001258851.1, NM_001271922.1 [P67812-3]
NP_055115.1, NM_014300.3 [P67812-1]

3D structure databases

SMRiP67812
ModBaseiSearch...

Protein-protein interaction databases

BioGridi117037, 23 interactors
DIPiDIP-50359N
IntActiP67812, 21 interactors
MINTiP67812
STRINGi9606.ENSP00000452697

Protein family/group databases

MEROPSiS26.009

PTM databases

iPTMnetiP67812
PhosphoSitePlusiP67812
SwissPalmiP67812

Polymorphism and mutation databases

BioMutaiSEC11A
DMDMi54039634

Proteomic databases

EPDiP67812
jPOSTiP67812
MassIVEiP67812
MaxQBiP67812
PaxDbiP67812
PeptideAtlasiP67812
PRIDEiP67812
ProteomicsDBi39571
39580
5197
57523 [P67812-1]
TopDownProteomicsiP67812-1 [P67812-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
23478
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000268220; ENSP00000268220; ENSG00000140612 [P67812-1]
ENST00000455959; ENSP00000413121; ENSG00000140612 [P67812-2]
ENST00000558134; ENSP00000452697; ENSG00000140612 [P67812-3]
ENST00000560266; ENSP00000452684; ENSG00000140612 [P67812-4]
GeneIDi23478
KEGGihsa:23478
UCSCiuc002blb.3 human [P67812-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23478
DisGeNETi23478

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SEC11A
HGNCiHGNC:17718 SEC11A
HPAiHPA047533
MIMi618258 gene
neXtProtiNX_P67812
OpenTargetsiENSG00000140612
PharmGKBiPA162402586

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3342 Eukaryota
COG0681 LUCA
GeneTreeiENSGT00390000015600
HOGENOMiHOG000111516
InParanoidiP67812
KOiK13280
OMAiMMWKGLG
OrthoDBi1486616at2759
PhylomeDBiP67812
TreeFamiTF313648

Enzyme and pathway databases

ReactomeiR-HSA-1799339 SRP-dependent cotranslational protein targeting to membrane
R-HSA-381771 Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
R-HSA-400511 Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
R-HSA-422085 Synthesis, secretion, and deacylation of Ghrelin

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SEC11A human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23478

Pharos

More...
Pharosi
P67812

Protein Ontology

More...
PROi
PR:P67812

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140612 Expressed in 235 organ(s), highest expression level in testis
ExpressionAtlasiP67812 baseline and differential
GenevisibleiP67812 HS

Family and domain databases

InterProiView protein in InterPro
IPR036286 LexA/Signal_pep-like_sf
IPR019758 Pept_S26A_signal_pept_1_CS
IPR019756 Pept_S26A_signal_pept_1_Ser-AS
IPR015927 Peptidase_S24_S26A/B/C
IPR001733 Peptidase_S26B
IPR037712 SEC11A
PANTHERiPTHR10806 PTHR10806, 1 hit
PTHR10806:SF18 PTHR10806:SF18, 1 hit
PfamiView protein in Pfam
PF00717 Peptidase_S24, 1 hit
PRINTSiPR00728 SIGNALPTASE
SUPFAMiSSF51306 SSF51306, 1 hit
TIGRFAMsiTIGR02228 sigpep_I_arch, 1 hit
PROSITEiView protein in PROSITE
PS00501 SPASE_I_1, 1 hit
PS00761 SPASE_I_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSC11A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P67812
Secondary accession number(s): B2RAD7
, B4DUL4, H0YK72, H0YK83, O75957, P21378, Q53FQ8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: October 11, 2004
Last modified: September 18, 2019
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again