Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P62070 (RRAS2_HUMAN)

Entry version 179 (07 Apr 2021)
Sequence version 1 (21 Jun 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Ras-related protein R-Ras2

Gene

RRAS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTP-binding protein with GTPase activity involved in the regulation of MAPK signaling pathway, thereby controlling multiple cellular processes (PubMed:31130282). Involved in the regulation of MAPK signaling pathway (PubMed:31130282, PubMed:31130285). Regulation of craniofacial development (PubMed:31130282, PubMed:31130285).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi21 – 29GTPCombined sources1 Publication9
Nucleotide bindingi68 – 72GTPBy similarity5
Nucleotide bindingi127 – 130GTPCombined sources1 Publication4
Nucleotide bindingi157 – 159GTPCombined sources1 Publication3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P62070

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P62070

SIGNOR Signaling Network Open Resource

More...SIGNORi		P62070

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-related protein R-Ras2 (EC:3.6.5.-1 Publication)
Alternative name(s):
Ras-like protein TC21
Teratocarcinoma oncogene
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RRAS2Imported
Synonyms:TC21
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:17271, RRAS2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600098, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P62070

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000133818.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Ovarian cancer (OC)1 Publication
Disease susceptibility is associated with variants affecting the gene represented in this entry.
Disease descriptionThe term ovarian cancer defines malignancies originating from ovarian tissue. Although many histologic types of ovarian tumors have been described, epithelial ovarian carcinoma is the most common form. Ovarian cancers are often asymptomatic and the recognized signs and symptoms, even of late-stage disease, are vague. Consequently, most patients are diagnosed with advanced disease.
Related information in OMIM
Noonan syndrome 12 (NS12)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA form of Noonan syndrome, a disease characterized by short stature, facial dysmorphic features such as hypertelorism, a downward eyeslant and low-set posteriorly rotated ears, and a high incidence of congenital heart defects and hypertrophic cardiomyopathy. Other features can include a short neck with webbing or redundancy of skin, deafness, motor delay, variable intellectual deficits, multiple skeletal defects, cryptorchidism, and bleeding diathesis. Individuals with Noonan syndrome are at risk of juvenile myelomonocytic leukemia, a myeloproliferative disorder characterized by excessive production of myelomonocytic cells. NS12 inheritance is autosomal dominant. There is considerable variability in severity.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08314923G → V in NS12; increased MAPK signaling. 1 Publication1
Natural variantiVAR_08315024G → GGGG in NS12; increased MAPK signaling. 1 Publication1
Natural variantiVAR_08315126G → GGVG in NS12; increased MAPK signaling; results in craniofacial patterning defects when expressed in zebrafish. 2 Publications1
Natural variantiVAR_08315270A → T in NS12; decreased GAP-stimulated GTPase activity leading to an accumulation of RRAS2 in its GTP-bound active state; increased MAPK signaling; loss of interaction with RASSF5. 1 PublicationCorresponds to variant dbSNP:rs782457908EnsemblClinVar.1
Natural variantiVAR_08315372Q → H in NS12; associated in cis with C-75; increased MAPK signaling; results in craniofacial patterning defects when expressed in zebrafish; results in craniofacial patterning defects in zebrafish when associated with C-75. 1 Publication1
Natural variantiVAR_00684872Q → L in NS12; also found as somatic mutation in ovarian cancer; increased MAPK signaling; results in craniofacial patterning defects when expressed in zebrafish. 3 PublicationsCorresponds to variant dbSNP:rs113954997EnsemblClinVar.1

Keywords - Diseasei

Disease variant, Proto-oncogene

Organism-specific databases

DisGeNET

More...DisGeNETi		22800

MalaCards human disease database

More...MalaCardsi		RRAS2
MIMi167000, phenotype
618624, phenotype

Open Targets

More...OpenTargetsi		ENSG00000133818

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA34862

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P62070, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RRAS2

Domain mapping of disease mutations (DMDM)

More...DMDMi		49065833

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000826522 – 201Ras-related protein R-Ras2Add BLAST200
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000281302202 – 204Removed in mature formBy similarity3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei186PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi199S-palmitoyl cysteineSequence analysis1
Modified residuei201Cysteine methyl esterCurated1
Lipidationi201S-farnesyl cysteine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

May be post-translationally modified by both palmitoylation and polyisoprenylation.1 Publication

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Palmitate, Phosphoprotein, Prenylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P62070

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P62070

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P62070

MaxQB - The MaxQuant DataBase

More...MaxQBi		P62070

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P62070

PeptideAtlas

More...PeptideAtlasi		P62070

PRoteomics IDEntifications database

More...PRIDEi		P62070

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		57360 [P62070-1]
57361 [P62070-2]
6730
6771

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P62070

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P62070

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P62070

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P62070

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000133818, Expressed in secondary oocyte and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P62070, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P62070, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000133818, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RASSF5.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		116480, 54 interactors

Protein interaction database and analysis system

More...IntActi		P62070, 43 interactors

Molecular INTeraction database

More...MINTi		P62070

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000256196

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P62070, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1204
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P62070

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P62070

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi43 – 51Effector region9

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the small GTPase superfamily. Ras family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0395, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155328

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P62070

Identification of Orthologs from Complete Genome Data

More...OMAi		QCVIDDI

Database of Orthologous Groups

More...OrthoDBi		1259506at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P62070

TreeFam database of animal gene trees

More...TreeFami		TF312796

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027417, P-loop_NTPase
IPR005225, Small_GTP-bd_dom
IPR001806, Small_GTPase
IPR020849, Small_GTPase_Ras-type

The PANTHER Classification System

More...PANTHERi		PTHR24070, PTHR24070, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00071, Ras, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540, SSF52540, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00231, small_GTP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51421, RAS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P62070-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAGWRDGS GQEKYRLVVV GGGGVGKSAL TIQFIQSYFV TDYDPTIEDS 
        60         70         80         90        100
YTKQCVIDDR AARLDILDTA GQEEFGAMRE QYMRTGEGFL LVFSVTDRGS 
       110        120        130        140        150
FEEIYKFQRQ ILRVKDRDEF PMILIGNKAD LDHQRQVTQE EGQQLARQLK 
       160        170        180        190        200
VTYMEASAKI RMNVDQAFHE LVRVIRKFQE QECPPSPEPT RKEKDKKGCH 

CVIF
Length:204
Mass (Da):23,400
Last modified:June 21, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBA7D4759DC49446F
GO
Isoform 2 (identifier: P62070-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-77: Missing.

Show »
Length:127
Mass (Da):15,094
Checksum:i58F3090C7A5F9B60
GO
Isoform 3 (identifier: P62070-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQ → M

Show »
Length:169
Mass (Da):19,841
Checksum:iA9C28F683B9E5A63
GO
Isoform 4 (identifier: P62070-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-36: Q → QFFLFLQ

Show »
Length:210
Mass (Da):24,196
Checksum:i881713C4D54A663E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PK85E9PK85_HUMAN
Ras-related protein R-Ras2
RRAS2
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQ87E9PQ87_HUMAN
Ras-related protein R-Ras2
RRAS2
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQK5E9PQK5_HUMAN
Ras-related protein R-Ras2
RRAS2
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQC5E9PQC5_HUMAN
Ras-related protein R-Ras2
RRAS2
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA36545 differs from that shown. Reason: Frameshift.Curated
The sequence AAM12638 differs from that shown. Reason: Frameshift.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08314923G → V in NS12; increased MAPK signaling. 1 Publication1
Natural variantiVAR_08315024G → GGGG in NS12; increased MAPK signaling. 1 Publication1
Natural variantiVAR_08315126G → GGVG in NS12; increased MAPK signaling; results in craniofacial patterning defects when expressed in zebrafish. 2 Publications1
Natural variantiVAR_08315270A → T in NS12; decreased GAP-stimulated GTPase activity leading to an accumulation of RRAS2 in its GTP-bound active state; increased MAPK signaling; loss of interaction with RASSF5. 1 PublicationCorresponds to variant dbSNP:rs782457908EnsemblClinVar.1
Natural variantiVAR_08315372Q → H in NS12; associated in cis with C-75; increased MAPK signaling; results in craniofacial patterning defects when expressed in zebrafish; results in craniofacial patterning defects in zebrafish when associated with C-75. 1 Publication1
Natural variantiVAR_00684872Q → L in NS12; also found as somatic mutation in ovarian cancer; increased MAPK signaling; results in craniofacial patterning defects when expressed in zebrafish. 3 PublicationsCorresponds to variant dbSNP:rs113954997EnsemblClinVar.1
Natural variantiVAR_08315475F → C Likely benign variant; associated in cis with H-72 in a patient with Noonan syndrome; has no effect on MAPK signaling; has no effect on craniofacial patterning when expressed in zebrafish; results in craniofacial patterning defects in zebrafish when associated with H-72. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0430661 – 77Missing in isoform 2. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_0444851 – 36MAAAG…IQFIQ → M in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_05584236Q → QFFLFLQ in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
M31468 mRNA Translation: AAA36545.1 Frameshift.
AF493924 mRNA Translation: AAM12638.1 Frameshift.
AK299606 mRNA Translation: BAH13078.1
AK300103 mRNA Translation: BAH13210.1
AK302033 mRNA Translation: BAH13612.1
AK313976 mRNA Translation: BAG36690.1
AC011084 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68487.1
BC013106 mRNA Translation: AAH13106.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44544.1 [P62070-2]
CCDS53603.1 [P62070-3]
CCDS7814.1 [P62070-1]

Protein sequence database of the Protein Information Resource

More...PIRi		B34788, TVHUC2

NCBI Reference Sequences

More...RefSeqi		NP_001096139.1, NM_001102669.2 [P62070-2]
NP_001170785.1, NM_001177314.1 [P62070-3]
NP_001170786.1, NM_001177315.1 [P62070-2]
NP_036382.2, NM_012250.5 [P62070-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000256196; ENSP00000256196; ENSG00000133818 [P62070-1]
ENST00000414023; ENSP00000403282; ENSG00000133818 [P62070-2]
ENST00000526063; ENSP00000434104; ENSG00000133818 [P62070-2]
ENST00000529237; ENSP00000433230; ENSG00000133818 [P62070-2]
ENST00000532814; ENSP00000431954; ENSG00000133818 [P62070-2]
ENST00000534746; ENSP00000437083; ENSG00000133818 [P62070-2]
ENST00000537760; ENSP00000437547; ENSG00000133818 [P62070-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		22800

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:22800

UCSC genome browser

More...UCSCi		uc001mlf.5, human [P62070-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M31468 mRNA Translation: AAA36545.1 Frameshift.
AF493924 mRNA Translation: AAM12638.1 Frameshift.
AK299606 mRNA Translation: BAH13078.1
AK300103 mRNA Translation: BAH13210.1
AK302033 mRNA Translation: BAH13612.1
AK313976 mRNA Translation: BAG36690.1
AC011084 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68487.1
BC013106 mRNA Translation: AAH13106.1
CCDSiCCDS44544.1 [P62070-2]
CCDS53603.1 [P62070-3]
CCDS7814.1 [P62070-1]
PIRiB34788, TVHUC2
RefSeqiNP_001096139.1, NM_001102669.2 [P62070-2]
NP_001170785.1, NM_001177314.1 [P62070-3]
NP_001170786.1, NM_001177315.1 [P62070-2]
NP_036382.2, NM_012250.5 [P62070-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ERYX-ray1.70A/B12-181[»]
SMRiP62070
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116480, 54 interactors
IntActiP62070, 43 interactors
MINTiP62070
STRINGi9606.ENSP00000256196

PTM databases

iPTMnetiP62070
MetOSiteiP62070
PhosphoSitePlusiP62070
SwissPalmiP62070

Genetic variation databases

BioMutaiRRAS2
DMDMi49065833

Proteomic databases

EPDiP62070
jPOSTiP62070
MassIVEiP62070
MaxQBiP62070
PaxDbiP62070
PeptideAtlasiP62070
PRIDEiP62070
ProteomicsDBi57360 [P62070-1]
57361 [P62070-2]
6730
6771

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		4173, 262 antibodies

The DNASU plasmid repository

More...DNASUi		22800

Genome annotation databases

EnsembliENST00000256196; ENSP00000256196; ENSG00000133818 [P62070-1]
ENST00000414023; ENSP00000403282; ENSG00000133818 [P62070-2]
ENST00000526063; ENSP00000434104; ENSG00000133818 [P62070-2]
ENST00000529237; ENSP00000433230; ENSG00000133818 [P62070-2]
ENST00000532814; ENSP00000431954; ENSG00000133818 [P62070-2]
ENST00000534746; ENSP00000437083; ENSG00000133818 [P62070-2]
ENST00000537760; ENSP00000437547; ENSG00000133818 [P62070-3]
GeneIDi22800
KEGGihsa:22800
UCSCiuc001mlf.5, human [P62070-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		22800
DisGeNETi22800

GeneCards: human genes, protein and diseases

More...GeneCardsi		RRAS2
HGNCiHGNC:17271, RRAS2
HPAiENSG00000133818, Low tissue specificity
MalaCardsiRRAS2
MIMi167000, phenotype
600098, gene
618624, phenotype
neXtProtiNX_P62070
OpenTargetsiENSG00000133818
PharmGKBiPA34862
VEuPathDBiHostDB:ENSG00000133818.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0395, Eukaryota
GeneTreeiENSGT00940000155328
InParanoidiP62070
OMAiQCVIDDI
OrthoDBi1259506at2759
PhylomeDBiP62070
TreeFamiTF312796

Enzyme and pathway databases

PathwayCommonsiP62070
SignaLinkiP62070
SIGNORiP62070

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		22800, 14 hits in 961 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RRAS2, human
EvolutionaryTraceiP62070

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RRAS2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		22800
PharosiP62070, Tbio

Protein Ontology

More...PROi		PR:P62070
RNActiP62070, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000133818, Expressed in secondary oocyte and 239 other tissues
ExpressionAtlasiP62070, baseline and differential
GenevisibleiP62070, HS

Family and domain databases

InterProiView protein in InterPro
IPR027417, P-loop_NTPase
IPR005225, Small_GTP-bd_dom
IPR001806, Small_GTPase
IPR020849, Small_GTPase_Ras-type
PANTHERiPTHR24070, PTHR24070, 1 hit
PfamiView protein in Pfam
PF00071, Ras, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit
TIGRFAMsiTIGR00231, small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51421, RAS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRRAS2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P62070
Secondary accession number(s): B2R9Z3
, B7Z5Z2, B7Z6C4, B7Z7H6, P17082
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 21, 2004
Last sequence update: June 21, 2004
Last modified: April 7, 2021
This is version 179 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again