Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P61966 (AP1S1_HUMAN)

Entry version 159 (25 May 2022)
Sequence version 1 (07 Jun 2004)
Previous versions | rss
Add a publicationFeedback
Protein

AP-1 complex subunit sigma-1A

Gene

AP1S1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P61966

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-164940, Nef mediated downregulation of MHC class I complex cell surface expression
R-HSA-2132295, MHC class II antigen presentation
R-HSA-432720, Lysosome Vesicle Biogenesis
R-HSA-432722, Golgi Associated Vesicle Biogenesis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P61966

SIGNOR Signaling Network Open Resource

More...SIGNORi		P61966

Protein family/group databases

Transport Classification Database

More...TCDBi		9.B.278.1.1, the organellar-targeting adaptor protein complex (o-apc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
AP-1 complex subunit sigma-1A
Alternative name(s):
Adaptor protein complex AP-1 subunit sigma-1A
Adaptor-related protein complex 1 subunit sigma-1A
Clathrin assembly protein complex 1 sigma-1A small chain
Clathrin coat assembly protein AP19
Golgi adaptor HA1/AP1 adaptin sigma-1A subunit
HA1 19 kDa subunit
Sigma 1a subunit of AP-1 clathrin
Sigma-adaptin 1A
Sigma1A-adaptin
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AP1S1
Synonyms:AP19, CLAPS1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:559, AP1S1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603531, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P61966

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000106367

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Coated pit, Cytoplasmic vesicle, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mental retardation, enteropathy, deafness, peripheral neuropathy, ichthyosis, and keratoderma (MEDNIK)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA disorder characterized by erythematous skin lesions and hyperkeratosis, severe psychomotor retardation, peripheral neuropathy, sensorineural hearing loss, together with elevated very-long-chain fatty acids and severe congenital diarrhea.
Related information in OMIM

Keywords - Diseasei

Deafness, Ichthyosis, Mental retardation, Neuropathy

Organism-specific databases

DisGeNET

More...DisGeNETi		1174

MalaCards human disease database

More...MalaCardsi		AP1S1
MIMi609313, phenotype

Open Targets

More...OpenTargetsi		ENSG00000106367

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		171851, MEDNIK syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24850

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P61966, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		AP1S1

Domain mapping of disease mutations (DMDM)

More...DMDMi		48428719

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001937971 – 158AP-1 complex subunit sigma-1AAdd BLAST158

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei147PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P61966

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P61966

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P61966

MaxQB - The MaxQuant DataBase

More...MaxQBi		P61966

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P61966

PeptideAtlas

More...PeptideAtlasi		P61966

PRoteomics IDEntifications database

More...PRIDEi		P61966

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		57348
57349 [P61966-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P61966, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P61966

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P61966

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P61966

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in response to enterovirus 71 (EV71) infection.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000106367, Expressed in caudate nucleus and 216 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P61966, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P61966, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000106367, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Adaptor protein complex 1 (AP-1) is a heterotetramer composed of two large adaptins (gamma-type subunit AP1G1 and beta-type subunit AP1B1), a medium adaptin (mu-type subunit AP1M1 or AP1M2) and a small adaptin (sigma-type subunit AP1S1 or AP1S2 or AP1S3).

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107588, 38 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-5047, Ubiquitous AP-1 Adaptor complex, sigma1a variant
CPX-5050, Endothelial AP-1 Adaptor complex, sigma1a variant

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P61966

Protein interaction database and analysis system

More...IntActi		P61966, 11 interactors

Molecular INTeraction database

More...MINTi		P61966

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000336666

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P61966, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1158
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		P61966

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P61966

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the adaptor complexes small subunit family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0934, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00970000193372

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_061221_1_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P61966

Identification of Orthologs from Complete Genome Data

More...OMAi		MIHFFIL

Database for complete collections of gene phylogenies

More...PhylomeDBi		P61966

TreeFam database of animal gene trees

More...TreeFami		TF312921

Family and domain databases

Conserved Domains Database

More...CDDi		cd14831, AP1_sigma, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR044733, AP1_sigma
IPR016635, AP_complex_ssu
IPR022775, AP_mu_sigma_su
IPR000804, Clathrin_sm-chain_CS
IPR011012, Longin-like_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR11753, PTHR11753, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01217, Clat_adaptor_s, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF015588, AP_complex_sigma, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF64356, SSF64356, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00989, CLAT_ADAPTOR_S, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P61966-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMRFMLLFSR QGKLRLQKWY LATSDKERKK MVRELMQVVL ARKPKMCSFL 
        60         70         80         90        100
EWRDLKVVYK RYASLYFCCA IEGQDNELIT LELIHRYVEL LDKYFGSVCE 
       110        120        130        140        150
LDIIFNFEKA YFILDEFLMG GDVQDTSKKS VLKAIEQADL LQEEDESPRS 

VLEEMGLA
Length:158
Mass (Da):18,733
Last modified:June 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE461937790406D8B
GO
Isoform 2 (identifier: P61966-2) [UniParc] [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-158: KKSVLKAIEQADLLQEEDESPRSVLEEMGLA → TFPFSH

Show »
Length:133
Mass (Da):16,011
Checksum:i3FB1FD64446EBFD6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8YGH5A0A2R8YGH5_HUMAN
AP complex subunit sigma
AP1S1
157Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C1E4H7C1E4_HUMAN
AP-1 complex subunit sigma-1A
AP1S1
191Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7S3A0A2R8Y7S3_HUMAN
AP-1 complex subunit sigma-1A
AP1S1
35Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD45829 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000171128 – 158KKSVL…EMGLA → TFPFSH in isoform 2. 2 PublicationsAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB015319 mRNA Translation: BAA33391.1
BT006779 mRNA Translation: AAP35425.1
AK312151 mRNA Translation: BAG35085.1
AC004876 Genomic DNA Translation: AAD45829.1 Different initiation.
CH471197 Genomic DNA Translation: EAW50199.1
BC003561 mRNA Translation: AAH03561.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47669.1

NCBI Reference Sequences

More...RefSeqi		NP_001274.1, NM_001283.3 [P61966-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000337619.11; ENSP00000336666.5; ENSG00000106367.15
ENST00000443943.5; ENSP00000410780.1; ENSG00000106367.15

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1174

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000337619.11; ENSP00000336666.5; NM_001283.5; NP_001274.1

UCSC genome browser

More...UCSCi		uc003uxv.5, human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB015319 mRNA Translation: BAA33391.1
BT006779 mRNA Translation: AAP35425.1
AK312151 mRNA Translation: BAG35085.1
AC004876 Genomic DNA Translation: AAD45829.1 Different initiation.
CH471197 Genomic DNA Translation: EAW50199.1
BC003561 mRNA Translation: AAH03561.1
CCDSiCCDS47669.1
RefSeqiNP_001274.1, NM_001283.3 [P61966-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4P6ZX-ray3.00S1-158[»]
AlphaFoldDBiP61966
SMRiP61966
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107588, 38 interactors
ComplexPortaliCPX-5047, Ubiquitous AP-1 Adaptor complex, sigma1a variant
CPX-5050, Endothelial AP-1 Adaptor complex, sigma1a variant
CORUMiP61966
IntActiP61966, 11 interactors
MINTiP61966
STRINGi9606.ENSP00000336666

Protein family/group databases

TCDBi9.B.278.1.1, the organellar-targeting adaptor protein complex (o-apc) family

PTM databases

GlyGeniP61966, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP61966
MetOSiteiP61966
PhosphoSitePlusiP61966

Genetic variation databases

BioMutaiAP1S1
DMDMi48428719

Proteomic databases

EPDiP61966
jPOSTiP61966
MassIVEiP61966
MaxQBiP61966
PaxDbiP61966
PeptideAtlasiP61966
PRIDEiP61966
ProteomicsDBi57348
57349 [P61966-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30972, 131 antibodies from 20 providers

The DNASU plasmid repository

More...DNASUi		1174

Genome annotation databases

EnsembliENST00000337619.11; ENSP00000336666.5; ENSG00000106367.15
ENST00000443943.5; ENSP00000410780.1; ENSG00000106367.15
GeneIDi1174
KEGGihsa:1174
MANE-SelectiENST00000337619.11; ENSP00000336666.5; NM_001283.5; NP_001274.1
UCSCiuc003uxv.5, human

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1174
DisGeNETi1174

GeneCards: human genes, protein and diseases

More...GeneCardsi		AP1S1
HGNCiHGNC:559, AP1S1
HPAiENSG00000106367, Low tissue specificity
MalaCardsiAP1S1
MIMi603531, gene
609313, phenotype
neXtProtiNX_P61966
OpenTargetsiENSG00000106367
Orphaneti171851, MEDNIK syndrome
PharmGKBiPA24850
VEuPathDBiHostDB:ENSG00000106367

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0934, Eukaryota
GeneTreeiENSGT00970000193372
HOGENOMiCLU_061221_1_3_1
InParanoidiP61966
OMAiMIHFFIL
PhylomeDBiP61966
TreeFamiTF312921

Enzyme and pathway databases

PathwayCommonsiP61966
ReactomeiR-HSA-164940, Nef mediated downregulation of MHC class I complex cell surface expression
R-HSA-2132295, MHC class II antigen presentation
R-HSA-432720, Lysosome Vesicle Biogenesis
R-HSA-432722, Golgi Associated Vesicle Biogenesis
SignaLinkiP61966
SIGNORiP61966

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		1174, 25 hits in 1077 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		AP1S1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		AP1S1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1174
PharosiP61966, Tbio

Protein Ontology

More...PROi		PR:P61966
RNActiP61966, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000106367, Expressed in caudate nucleus and 216 other tissues
ExpressionAtlasiP61966, baseline and differential
GenevisibleiP61966, HS

Family and domain databases

CDDicd14831, AP1_sigma, 1 hit
InterProiView protein in InterPro
IPR044733, AP1_sigma
IPR016635, AP_complex_ssu
IPR022775, AP_mu_sigma_su
IPR000804, Clathrin_sm-chain_CS
IPR011012, Longin-like_dom_sf
PANTHERiPTHR11753, PTHR11753, 1 hit
PfamiView protein in Pfam
PF01217, Clat_adaptor_s, 1 hit
PIRSFiPIRSF015588, AP_complex_sigma, 1 hit
SUPFAMiSSF64356, SSF64356, 1 hit
PROSITEiView protein in PROSITE
PS00989, CLAT_ADAPTOR_S, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAP1S1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P61966
Secondary accession number(s): B2R5D8
, P82267, Q00382, Q53YA7, Q9BTN4, Q9UDW9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: June 7, 2004
Last modified: May 25, 2022
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again