Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (12 Aug 2020)
Sequence version 1 (07 Jun 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Coatomer subunit zeta-1

Gene

COPZ1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins (By similarity). The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P61923

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6807878, COPI-mediated anterograde transport
R-HSA-6811434, COPI-dependent Golgi-to-ER retrograde traffic

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coatomer subunit zeta-1
Alternative name(s):
Zeta-1-coat protein
Short name:
Zeta-1 COP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:COPZ1
Synonyms:COPZ
ORF Names:CGI-120, HSPC181
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000111481.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2243, COPZ1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615472, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P61923

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi58 – 59EI → KA: Reduced interaction with gamma subunit. 1 Publication2
Mutagenesisi87 – 88EL → KA: Reduced interaction with gamma subunit. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
22818

Open Targets

More...
OpenTargetsi
ENSG00000111481

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26760

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P61923, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
COPZ1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
48428830

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001938251 – 177Coatomer subunit zeta-1Add BLAST177

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P61923

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P61923

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P61923

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P61923

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P61923

PeptideAtlas

More...
PeptideAtlasi
P61923

PRoteomics IDEntifications database

More...
PRIDEi
P61923

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
28529
28992
3904
4260
57338 [P61923-1]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P61923-1 [P61923-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P61923

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
P61923

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P61923

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111481, Expressed in islet of Langerhans and 239 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P61923, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P61923, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000111481, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Oligomeric complex that consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116495, 57 interactors

Database of interacting proteins

More...
DIPi
DIP-29873N

Protein interaction database and analysis system

More...
IntActi
P61923, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000449270

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P61923, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P61923

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P61923

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3343, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004405

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_086803_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P61923

KEGG Orthology (KO)

More...
KOi
K20472

Database of Orthologous Groups

More...
OrthoDBi
1522668at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P61923

TreeFam database of animal gene trees

More...
TreeFami
TF300262

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022775, AP_mu_sigma_su
IPR000804, Clathrin_sm-chain_CS
IPR039652, Coatomer_zeta
IPR011012, Longin-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11043, PTHR11043, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01217, Clat_adaptor_s, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF64356, SSF64356, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00989, CLAT_ADAPTOR_S, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P61923-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEALILEPSL YTVKAILILD NDGDRLFAKY YDDTYPSVKE QKAFEKNIFN
60 70 80 90 100
KTHRTDSEIA LLEGLTVVYK SSIDLYFYVI GSSYENELML MAVLNCLFDS
110 120 130 140 150
LSQMLRKNVE KRALLENMEG LFLAVDEIVD GGVILESDPQ QVVHRVALRG
160 170
EDVPLTEQTV SQVLQSAKEQ IKWSLLR
Length:177
Mass (Da):20,198
Last modified:June 7, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i355530D032D3A049
GO
Isoform 2 (identifier: P61923-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYP → MMEIDFLPSTMTTPTPVSRSKRPLRRTFSTRPIGLT
     37-87: Missing.

Show »
Length:126
Mass (Da):14,253
Checksum:i63729DA05B6CAA87
GO
Isoform 3 (identifier: P61923-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     7-29: Missing.

Show »
Length:154
Mass (Da):17,624
Checksum:iB72D2F0155584233
GO
Isoform 4 (identifier: P61923-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MEALIL → MGGFRTEGMFVSLQ

Show »
Length:185
Mass (Da):21,069
Checksum:i16ABA633D4510033
GO
Isoform 5 (identifier: P61923-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     147-163: Missing.

Show »
Length:160
Mass (Da):18,374
Checksum:iF13D7FACABD98416
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VVA7F8VVA7_HUMAN
Coatomer subunit zeta
COPZ1
198Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXR1F8VXR1_HUMAN
Coatomer subunit zeta
COPZ1
138Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VYZ4F8VYZ4_HUMAN
Coatomer subunit zeta
COPZ1
163Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXB1F8VXB1_HUMAN
Coatomer subunit zeta
COPZ1
92Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VYE0F8VYE0_HUMAN
Coatomer subunit zeta
COPZ1
164Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W156F8W156_HUMAN
Coatomer subunit zeta
COPZ1
107Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W651F8W651_HUMAN
Coatomer subunit zeta
COPZ1
119Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VYK5F8VYK5_HUMAN
Coatomer subunit zeta
COPZ1
89Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUC5F8VUC5_HUMAN
Coatomer subunit zeta
COPZ1
95Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0536751 – 36MEALI…DDTYP → MMEIDFLPSTMTTPTPVSRS KRPLRRTFSTRPIGLT in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0550491 – 6MEALIL → MGGFRTEGMFVSLQ in isoform 4. Curated6
Alternative sequenceiVSP_0550507 – 29Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_05367637 – 87Missing in isoform 2. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_055051147 – 163Missing in isoform 5. CuratedAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB047848 mRNA Translation: BAB17659.1
AF151878 mRNA Translation: AAD34115.1
AF161529 mRNA Translation: AAF29144.1
AF086911 mRNA Translation: AAP97141.1
AK293377 mRNA Translation: BAG56889.1
AK295325 mRNA Translation: BAG58302.1
AC078778 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW96774.1
BC002849 mRNA Translation: AAH02849.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS61137.1 [P61923-5]
CCDS61138.1 [P61923-3]
CCDS61139.1 [P61923-4]
CCDS8877.1 [P61923-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001258663.1, NM_001271734.1 [P61923-3]
NP_001258664.1, NM_001271735.1 [P61923-5]
NP_001258665.1, NM_001271736.1 [P61923-4]
NP_057141.1, NM_016057.2 [P61923-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262061; ENSP00000262061; ENSG00000111481 [P61923-1]
ENST00000455864; ENSP00000410620; ENSG00000111481 [P61923-3]
ENST00000549043; ENSP00000449270; ENSG00000111481 [P61923-4]
ENST00000552362; ENSP00000448444; ENSG00000111481 [P61923-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
22818

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:22818

UCSC genome browser

More...
UCSCi
uc001sfs.3, human [P61923-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB047848 mRNA Translation: BAB17659.1
AF151878 mRNA Translation: AAD34115.1
AF161529 mRNA Translation: AAF29144.1
AF086911 mRNA Translation: AAP97141.1
AK293377 mRNA Translation: BAG56889.1
AK295325 mRNA Translation: BAG58302.1
AC078778 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW96774.1
BC002849 mRNA Translation: AAH02849.1
CCDSiCCDS61137.1 [P61923-5]
CCDS61138.1 [P61923-3]
CCDS61139.1 [P61923-4]
CCDS8877.1 [P61923-1]
RefSeqiNP_001258663.1, NM_001271734.1 [P61923-3]
NP_001258664.1, NM_001271735.1 [P61923-5]
NP_001258665.1, NM_001271736.1 [P61923-4]
NP_057141.1, NM_016057.2 [P61923-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2HF6NMR-A1-149[»]
5MC7X-ray1.60A/B7-150[»]
SMRiP61923
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116495, 57 interactors
DIPiDIP-29873N
IntActiP61923, 12 interactors
STRINGi9606.ENSP00000449270

PTM databases

iPTMnetiP61923
MetOSiteiP61923
PhosphoSitePlusiP61923

Polymorphism and mutation databases

BioMutaiCOPZ1
DMDMi48428830

Proteomic databases

EPDiP61923
jPOSTiP61923
MassIVEiP61923
MaxQBiP61923
PaxDbiP61923
PeptideAtlasiP61923
PRIDEiP61923
ProteomicsDBi28529
28992
3904
4260
57338 [P61923-1]
TopDownProteomicsiP61923-1 [P61923-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
27430, 206 antibodies

The DNASU plasmid repository

More...
DNASUi
22818

Genome annotation databases

EnsembliENST00000262061; ENSP00000262061; ENSG00000111481 [P61923-1]
ENST00000455864; ENSP00000410620; ENSG00000111481 [P61923-3]
ENST00000549043; ENSP00000449270; ENSG00000111481 [P61923-4]
ENST00000552362; ENSP00000448444; ENSG00000111481 [P61923-5]
GeneIDi22818
KEGGihsa:22818
UCSCiuc001sfs.3, human [P61923-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22818
DisGeNETi22818
EuPathDBiHostDB:ENSG00000111481.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
COPZ1
HGNCiHGNC:2243, COPZ1
HPAiENSG00000111481, Low tissue specificity
MIMi615472, gene
neXtProtiNX_P61923
OpenTargetsiENSG00000111481
PharmGKBiPA26760

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3343, Eukaryota
GeneTreeiENSGT00390000004405
HOGENOMiCLU_086803_2_0_1
InParanoidiP61923
KOiK20472
OrthoDBi1522668at2759
PhylomeDBiP61923
TreeFamiTF300262

Enzyme and pathway databases

PathwayCommonsiP61923
ReactomeiR-HSA-6807878, COPI-mediated anterograde transport
R-HSA-6811434, COPI-dependent Golgi-to-ER retrograde traffic

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
22818, 706 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
COPZ1, human
EvolutionaryTraceiP61923

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
COPZ1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
22818
PharosiP61923, Tbio

Protein Ontology

More...
PROi
PR:P61923
RNActiP61923, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111481, Expressed in islet of Langerhans and 239 other tissues
ExpressionAtlasiP61923, baseline and differential
GenevisibleiP61923, HS

Family and domain databases

InterProiView protein in InterPro
IPR022775, AP_mu_sigma_su
IPR000804, Clathrin_sm-chain_CS
IPR039652, Coatomer_zeta
IPR011012, Longin-like_dom_sf
PANTHERiPTHR11043, PTHR11043, 1 hit
PfamiView protein in Pfam
PF01217, Clat_adaptor_s, 1 hit
SUPFAMiSSF64356, SSF64356, 1 hit
PROSITEiView protein in PROSITE
PS00989, CLAT_ADAPTOR_S, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCOPZ1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P61923
Secondary accession number(s): B4DDX8
, B4DHZ0, F8VS17, F8VWL5, Q549N6, Q9Y3C3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: June 7, 2004
Last modified: August 12, 2020
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again