Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (07 Oct 2020)
Sequence version 4 (10 Apr 2019)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Prefoldin subunit 3

Gene

VBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • tubulin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChaperone

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P61758

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-389957, Prefoldin mediated transfer of substrate to CCT/TriC

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Prefoldin subunit 3
Alternative name(s):
HIBBJ46
von Hippel-Lindau-binding protein 1
Short name:
VBP-1
Short name:
VHL-binding protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VBP1
Synonyms:PFDN3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000155959.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12662, VBP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300133, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P61758

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7411

Open Targets

More...
OpenTargetsi
ENSG00000155959

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37285

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P61758, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VBP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
125987848

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001536522 – 197Prefoldin subunit 3Add BLAST196

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei59N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P61758

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P61758

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P61758

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P61758

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P61758

PeptideAtlas

More...
PeptideAtlasi
P61758

PRoteomics IDEntifications database

More...
PRIDEi
P61758

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25914
57330

2D gel databases

USC-OGP 2-DE database

More...
OGPi
P61758

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P61758

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
P61758

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P61758

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155959, Expressed in female gonad and 248 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P61758, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000155959, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterohexamer of two PFD-alpha type and four PFD-beta type subunits. Binds to the C-terminal part of VHL.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
113254, 118 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P61758

Database of interacting proteins

More...
DIPi
DIP-46479N

Protein interaction database and analysis system

More...
IntActi
P61758, 59 interactors

Molecular INTeraction database

More...
MINTi
P61758

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000286428

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P61758, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P61758

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the prefoldin subunit alpha family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3313, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018904

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_083737_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P61758

Identification of Orthologs from Complete Genome Data

More...
OMAi
EPMETHF

Database of Orthologous Groups

More...
OrthoDBi
1567796at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P61758

TreeFam database of animal gene trees

More...
TreeFami
TF313706

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.287.370, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016655, PFD3
IPR009053, Prefoldin
IPR004127, Prefoldin_subunit_alpha

The PANTHER Classification System

More...
PANTHERi
PTHR12409, PTHR12409, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02996, Prefoldin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF016396, Prefoldin_subunit_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P61758-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAVKDSCGK GEMATGNGRR LHLGIPEAVF VEDVDSFMKQ PGNETADTVL
60 70 80 90 100
KKLDEQYQKY KFMELNLAQK KRRLKGQIPE IKQTLEILKY MQKKKESTNS
110 120 130 140 150
METRFLLADN LYCKASVPPT DKVCLWLGAN VMLEYDIDEA QALLEKNLST
160 170 180 190
ATKNLDSLEE DLDFLRDQFT TTEVNMARVY NWDVKRRNKD DSTKNKA
Length:197
Mass (Da):22,626
Last modified:April 10, 2019 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i973BA048048D948E
GO
Isoform 2 (identifier: P61758-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MAAVKDSCGKGEMATGNGRRLHLGIPEAVFV → MAPQPMIHTQQGLRTSSPSTPSPEHQ

Show »
Length:192
Mass (Da):22,254
Checksum:i28F9A21B06C7B7D9
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC23907 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023371123V → M1 PublicationCorresponds to variant dbSNP:rs572013Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0600811 – 31MAAVK…EAVFV → MAPQPMIHTQQGLRTSSPST PSPEHQ in isoform 2. Add BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U96759 mRNA Translation: AAC23907.1 Different initiation.
Y17394 mRNA Translation: CAA76761.1
AK301646 mRNA Translation: BAG63125.1
AK313420 mRNA Translation: BAG36212.1
BT019604 mRNA Translation: AAV38411.1
AL356738 Genomic DNA Translation: CAI41469.1
BX682237 Genomic DNA No translation available.
BC046094 mRNA Translation: AAH46094.1
U56833 mRNA Translation: AAC50617.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14765.1 [P61758-1]
CCDS78525.1 [P61758-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001290472.1, NM_001303543.1
NP_001290473.1, NM_001303544.1 [P61758-2]
NP_001290474.1, NM_001303545.1
NP_003363.1, NM_003372.6 [P61758-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000286428; ENSP00000286428; ENSG00000155959 [P61758-1]
ENST00000535916; ENSP00000438694; ENSG00000155959 [P61758-2]
ENST00000625964; ENSP00000486053; ENSG00000155959 [P61758-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7411

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7411

UCSC genome browser

More...
UCSCi
uc004fnc.4, human [P61758-1]
uc065cjx.1, human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U96759 mRNA Translation: AAC23907.1 Different initiation.
Y17394 mRNA Translation: CAA76761.1
AK301646 mRNA Translation: BAG63125.1
AK313420 mRNA Translation: BAG36212.1
BT019604 mRNA Translation: AAV38411.1
AL356738 Genomic DNA Translation: CAI41469.1
BX682237 Genomic DNA No translation available.
BC046094 mRNA Translation: AAH46094.1
U56833 mRNA Translation: AAC50617.1
CCDSiCCDS14765.1 [P61758-1]
CCDS78525.1 [P61758-2]
RefSeqiNP_001290472.1, NM_001303543.1
NP_001290473.1, NM_001303544.1 [P61758-2]
NP_001290474.1, NM_001303545.1
NP_003363.1, NM_003372.6 [P61758-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6NR8electron microscopy7.80349-180[»]
6NR9electron microscopy8.50349-180[»]
6NRBelectron microscopy8.70349-180[»]
6NRCelectron microscopy8.30349-180[»]
6NRDelectron microscopy8.20349-180[»]
SMRiP61758
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi113254, 118 interactors
CORUMiP61758
DIPiDIP-46479N
IntActiP61758, 59 interactors
MINTiP61758
STRINGi9606.ENSP00000286428

PTM databases

iPTMnetiP61758
MetOSiteiP61758
PhosphoSitePlusiP61758

Polymorphism and mutation databases

BioMutaiVBP1
DMDMi125987848

2D gel databases

OGPiP61758

Proteomic databases

EPDiP61758
jPOSTiP61758
MassIVEiP61758
MaxQBiP61758
PaxDbiP61758
PeptideAtlasiP61758
PRIDEiP61758
ProteomicsDBi25914
57330

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3341, 351 antibodies

The DNASU plasmid repository

More...
DNASUi
7411

Genome annotation databases

EnsembliENST00000286428; ENSP00000286428; ENSG00000155959 [P61758-1]
ENST00000535916; ENSP00000438694; ENSG00000155959 [P61758-2]
ENST00000625964; ENSP00000486053; ENSG00000155959 [P61758-2]
GeneIDi7411
KEGGihsa:7411
UCSCiuc004fnc.4, human [P61758-1]
uc065cjx.1, human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7411
DisGeNETi7411
EuPathDBiHostDB:ENSG00000155959.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VBP1
HGNCiHGNC:12662, VBP1
HPAiENSG00000155959, Low tissue specificity
MIMi300133, gene
neXtProtiNX_P61758
OpenTargetsiENSG00000155959
PharmGKBiPA37285

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3313, Eukaryota
GeneTreeiENSGT00390000018904
HOGENOMiCLU_083737_1_0_1
InParanoidiP61758
OMAiEPMETHF
OrthoDBi1567796at2759
PhylomeDBiP61758
TreeFamiTF313706

Enzyme and pathway databases

PathwayCommonsiP61758
ReactomeiR-HSA-389957, Prefoldin mediated transfer of substrate to CCT/TriC

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
7411, 108 hits in 502 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
VBP1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7411
PharosiP61758, Tbio

Protein Ontology

More...
PROi
PR:P61758
RNActiP61758, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000155959, Expressed in female gonad and 248 other tissues
GenevisibleiP61758, HS

Family and domain databases

Gene3Di1.10.287.370, 1 hit
InterProiView protein in InterPro
IPR016655, PFD3
IPR009053, Prefoldin
IPR004127, Prefoldin_subunit_alpha
PANTHERiPTHR12409, PTHR12409, 1 hit
PfamiView protein in Pfam
PF02996, Prefoldin, 1 hit
PIRSFiPIRSF016396, Prefoldin_subunit_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPFD3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P61758
Secondary accession number(s): B2R8L5
, B4DWR3, F5H2A7, O55228, Q15765, Q5JT81, Q86X96
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2004
Last sequence update: April 10, 2019
Last modified: October 7, 2020
This is version 148 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again