UniProtKB - P61421 (VA0D1_HUMAN)

BLAST

>sp|P61421|VA0D1_HUMAN V-type proton ATPase subunit d 1 OS=Homo sapiens OX=9606 GN=ATP6V0D1 PE=1 SV=1
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLAN
EASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQR
SIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEI
IRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKL
FPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVK
LNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Align
Format
Add to basket Added to basket
History
Entry version 141 (07 Nov 2018)
Sequence version 1 (24 May 2004)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

V-type proton ATPase subunit d 1

Gene

ATP6V0D1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis (By similarity). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe²⁺ prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation (PubMed:28296633).By similarity1 Publication

GO - Molecular functionⁱ

protein-containing complex binding Source: Ensembl
proton-exporting ATPase activity, phosphorylative mechanism
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
proton-transporting ATPase activity, rotational mechanism
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

ATP hydrolysis coupled proton transport Source: InterPro
brain development Source: Ensembl
cellular iron ion homeostasis
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 28296633
cellular response to increased oxygen levels
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 28296633
cilium assembly Source: UniProtKB
insulin receptor signaling pathway Source: Reactome
ion transmembrane transport Source: Reactome
IRE1-mediated unfolded protein response Source: Reactome
proton transmembrane transport
Source: UniProtKB
Non-traceable author statementⁱ
- 11118322
regulation of macroautophagy
Source: ParkinsonsUK-UCL
Non-traceable author statementⁱ
- 22982048
transferrin transport Source: Reactome
vacuolar acidification
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635
vacuolar transport
Source: GO_Central
Inferred from biological aspect of ancestorⁱ
- 21873635

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Cilium biogenesis/degradation, Hydrogen ion transport, Ion transport, Transport

Biological process

Cilium biogenesis/degradation, Hydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS08417-MONOMER
Reactomeⁱ	R-HSA-1222556 ROS, RNS production in phagocytes R-HSA-381038 XBP1(S) activates chaperone genes R-HSA-77387 Insulin receptor recycling R-HSA-917977 Transferrin endocytosis and recycling R-HSA-983712 Ion channel transport

Protein family/group databases

TCDBⁱ	3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

TCDBⁱ

3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: V-type proton ATPase subunit d 1 Short name: V-ATPase subunit d 1 Alternative name(s): 32 kDa accessory protein V-ATPase 40 kDa accessory protein V-ATPase AC39 subunit Short name: p39 Vacuolar proton pump subunit d 1
Gene namesⁱ	Name:ATP6V0D1 Synonyms:ATP6D, VPATPD
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 16

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000159720.11
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:13724 ATP6V0D1
MIMⁱ	607028 gene
neXtProtⁱ	NX_P61421

Keywords - Cellular componentⁱ

Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	9114
Open Targets More...OpenTargetsⁱ	ENSG00000159720
PharmGKBⁱ	PA25150

Polymorphism and mutation databases

BioMutaⁱ	ATP6V0D1
DMDMⁱ	47606646

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000119350	1 – 351	V-type proton ATPase subunit d 1Add BLAST		351

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	270	PhosphotyrosineBy similarity		1
Modified residueⁱ	283	PhosphoserineBy similarity		1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	P61421
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P61421
PaxDbⁱ	P61421
PeptideAtlas More...PeptideAtlasⁱ	P61421
PRIDEⁱ	P61421
ProteomicsDBⁱ	57300

PTM databases

iPTMnetⁱ	P61421
PhosphoSitePlusⁱ	P61421
SwissPalmⁱ	P61421

Expressionⁱ

Tissue specificityⁱ

Ubiquitous.2 Publications

Gene expression databases

Bgeeⁱ	ENSG00000159720 Expressed in 234 organ(s), highest expression level in Ammon's horn
CleanExⁱ	HS_ATP6V0D1
ExpressionAtlasⁱ	P61421 baseline and differential
Genevisibleⁱ	P61421 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA016938

HPAⁱ

HPA016938

Interactionⁱ

Subunit structureⁱ

V-ATPase is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d).

Protein-protein interaction databases

BioGridⁱ	114564, 125 interactors
Database of interacting proteins More...DIPⁱ	DIP-47435N
IntActⁱ	P61421, 46 interactors
Molecular INTeraction database More...MINTⁱ	P61421
STRINGⁱ	9606.ENSP00000290949

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P61421
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the V-ATPase V0D/AC39 subunit family.Curated

Phylogenomic databases

eggNOGⁱ	KOG2957 Eukaryota COG1527 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000002200
HOGENOMⁱ	HOG000199065
HOVERGENⁱ	HBG018065
InParanoidⁱ	P61421
KEGG Orthology (KO) More...KOⁱ	K02146
PhylomeDBⁱ	P61421
TreeFamⁱ	TF300857

Family and domain databases

Gene3Dⁱ	1.20.1690.10, 2 hits
InterProⁱ	View protein in InterPro IPR036079 ATPase_su_C-like IPR002843 ATPase_V0-cplx_csu/dsu IPR016727 ATPase_V0-cplx_dsu IPR035067 V-type_ATPase_suC
PANTHERⁱ	PTHR11028 PTHR11028, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01992 vATP-synt_AC39, 1 hit
PIRSFⁱ	PIRSF018497 V-ATP_synth_D, 1 hit
SUPFAMⁱ	SSF103486 SSF103486, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 11 potential isoforms that are computationally mapped.Show all Align All

P61421-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSFFPELYFN VDNGYLEGLV RGLKAGVLSQ ADYLNLVQCE TLEDLKLHLQ 
        60         70         80         90        100
STDYGNFLAN EASPLTVSVI DDRLKEKMVV EFRHMRNHAY EPLASFLDFI 
       110        120        130        140        150
TYSYMIDNVI LLITGTLHQR SIAELVPKCH PLGSFEQMEA VNIAQTPAEL 
       160        170        180        190        200
YNAILVDTPL AAFFQDCISE QDLDEMNIEI IRNTLYKAYL ESFYKFCTLL 
       210        220        230        240        250
GGTTADAMCP ILEFEADRRA FIITINSFGT ELSKEDRAKL FPHCGRLYPE 
       260        270        280        290        300
GLAQLARADD YEQVKNVADY YPEYKLLFEG AGSNPGDKTL EDRFFEHEVK 
       310        320        330        340        350
LNKLAFLNQF HFGVFYAFVK LKEQECRNIV WIAECIAQRH RAKIDNYIPI 

F

Length:351

Mass (Da):40,329

Last modified:May 24, 2004 - v1

Checksum:ⁱA720F8A87511203C

Computationally mapped potential isoform sequencesⁱ

There are 11 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name	Protein names	Gene names	Length	Annotation

	F5GYQ1	F5GYQ1_HUMAN	V-type proton ATPase subunit V-type proton ATPase subunit	ATP6V0D1	392	Annotation score:
	R4GN72	R4GN72_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	274	Annotation score:
	H3BSG7	H3BSG7_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	115	Annotation score:
	J3QL14	J3QL14_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	232	Annotation score:
	H3BQB4	H3BQB4_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	113	Annotation score:
	H3BUQ0	H3BUQ0_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	47	Annotation score:
	H3BQJ1	H3BQJ1_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	227	Annotation score:
	H3BTB5	H3BTB5_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	57	Annotation score:
	F8WEN9	F8WEN9_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	58	Annotation score:
	H3BPS0	H3BPS0_HUMAN	V-type proton ATPase subunit d 1 V-type proton ATPase subunit d 1	ATP6V0D1	71	Annotation score:
There is more potential isoformShow all

Sequence cautionⁱ

The sequence CAA50591 differs from that shown. Reason: Frameshift at positions 22, 25, 64 and 66.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	27	V → E in CAA50591 (PubMed:8250920).Curated		1
Sequence conflictⁱ	266 – 267	NV → KL in CAA50591 (PubMed:8250920).Curated		2

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X71490 mRNA Translation: CAA50591.1 Frameshift. BC008861 mRNA Translation: AAH08861.1 L05087 mRNA Translation: AAC15852.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10838.1
NCBI Reference Sequences More...RefSeqⁱ	NP_004682.2, NM_004691.4
UniGeneⁱ	Hs.106876

Genome annotation databases

Ensemblⁱ	ENST00000290949; ENSP00000290949; ENSG00000159720
GeneIDⁱ	9114
KEGGⁱ	hsa:9114
UCSC genome browser More...UCSCⁱ	uc002ete.2 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P61421	V-type proton ATPase subunit d 1		BOVIN		351	UniRef100_P61421
V-type proton ATPase subunit d 1		PONAB		351
V-type proton ATPase subunit		PANTR		351
V-type proton ATPase subunit		CALJA		351
V-type proton ATPase subunit		MACMU		351
+27

Protein	Similar proteins		Species	Score	Length	Source
P61421	V-type proton ATPase subunit d 1		BOVIN		351	UniRef90_P61421
V-type proton ATPase subunit d 1		PONAB		351
V-type proton ATPase subunit d 1		MOUSE		351
V-type proton ATPase subunit d 1		DANRE		350
V-type proton ATPase subunit		PANTR		351
+155

Protein	Similar proteins		Species	Score	Length	Source
P61421	V-type proton ATPase subunit d 1		BOVIN		351	UniRef50_P61421
V-type proton ATPase subunit d 1		PONAB		351
V-type proton ATPase subunit d 1		MOUSE		351
V-type proton ATPase subunit d 1		DANRE		350
V-type proton ATPase subunit		PANTR		351
+173

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X71490 mRNA Translation: CAA50591.1 Frameshift. BC008861 mRNA Translation: AAH08861.1 L05087 mRNA Translation: AAC15852.1
CCDSⁱ	CCDS10838.1
RefSeqⁱ	NP_004682.2, NM_004691.4
UniGeneⁱ	Hs.106876

3D structure databases

ProteinModelPortalⁱ	P61421
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	114564, 125 interactors
DIPⁱ	DIP-47435N
IntActⁱ	P61421, 46 interactors
MINTⁱ	P61421
STRINGⁱ	9606.ENSP00000290949

Protein family/group databases

TCDBⁱ	3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

TCDBⁱ

3.A.2.2.4 the h(+)- or na(+)-translocating f-type, v-type and a-type atpase (f-atpase) superfamily

PTM databases

iPTMnetⁱ	P61421
PhosphoSitePlusⁱ	P61421
SwissPalmⁱ	P61421

Polymorphism and mutation databases

BioMutaⁱ	ATP6V0D1
DMDMⁱ	47606646

Proteomic databases

EPDⁱ	P61421
MaxQBⁱ	P61421
PaxDbⁱ	P61421
PeptideAtlasⁱ	P61421
PRIDEⁱ	P61421
ProteomicsDBⁱ	57300

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	9114
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000290949; ENSP00000290949; ENSG00000159720
GeneIDⁱ	9114
KEGGⁱ	hsa:9114
UCSCⁱ	uc002ete.2 human

Organism-specific databases

CTDⁱ	9114
DisGeNETⁱ	9114
EuPathDBⁱ	HostDB:ENSG00000159720.11
GeneCardsⁱ	ATP6V0D1
HGNCⁱ	HGNC:13724 ATP6V0D1
HPAⁱ	HPA016938
MIMⁱ	607028 gene
neXtProtⁱ	NX_P61421
OpenTargetsⁱ	ENSG00000159720
PharmGKBⁱ	PA25150
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2957 Eukaryota COG1527 LUCA
GeneTreeⁱ	ENSGT00390000002200
HOGENOMⁱ	HOG000199065
HOVERGENⁱ	HBG018065
InParanoidⁱ	P61421
KOⁱ	K02146
PhylomeDBⁱ	P61421
TreeFamⁱ	TF300857

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS08417-MONOMER
Reactomeⁱ	R-HSA-1222556 ROS, RNS production in phagocytes R-HSA-381038 XBP1(S) activates chaperone genes R-HSA-77387 Insulin receptor recycling R-HSA-917977 Transferrin endocytosis and recycling R-HSA-983712 Ion channel transport

Miscellaneous databases

ChiTaRSⁱ	ATP6V0D1 human
GeneWikiⁱ	ATP6V0D1
GenomeRNAiⁱ	9114
Protein Ontology More...PROⁱ	PR:P61421
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000159720 Expressed in 234 organ(s), highest expression level in Ammon's horn
CleanExⁱ	HS_ATP6V0D1
ExpressionAtlasⁱ	P61421 baseline and differential
Genevisibleⁱ	P61421 HS

Family and domain databases

Gene3Dⁱ	1.20.1690.10, 2 hits
InterProⁱ	View protein in InterPro IPR036079 ATPase_su_C-like IPR002843 ATPase_V0-cplx_csu/dsu IPR016727 ATPase_V0-cplx_dsu IPR035067 V-type_ATPase_suC
PANTHERⁱ	PTHR11028 PTHR11028, 1 hit
Pfamⁱ	View protein in Pfam PF01992 vATP-synt_AC39, 1 hit
PIRSFⁱ	PIRSF018497 V-ATP_synth_D, 1 hit
SUPFAMⁱ	SSF103486 SSF103486, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	VA0D1_HUMAN
Accessionⁱ	P61421Primary (citable) accession number: P61421 Secondary accession number(s): P12953, Q02547
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 24, 2004
	Last sequence update:	May 24, 2004
	Last modified:	November 7, 2018
	This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human chromosome 16
Human chromosome 16: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P61421 (VA0D1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

V-type proton ATPase subunit d 1

ATP6V0D1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Endosome

Extracellular region or secreted

Lysosome

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ