Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibroblast growth factor 12

Gene

Fgf12

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in nervous system development and function. Promote neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

ReactomeiR-MMU-5576892 Phase 0 - rapid depolarisation

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 12
Short name:
FGF-12
Alternative name(s):
Fibroblast growth factor homologous factor 1
Short name:
FHF-1
Myocyte-activating factor
Gene namesi
Name:Fgf12
Synonyms:Fhf1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:109183 Fgf12

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001476051 – 243Fibroblast growth factor 12Add BLAST243

Proteomic databases

MaxQBiP61329
PaxDbiP61329
PeptideAtlasiP61329
PRIDEiP61329

PTM databases

iPTMnetiP61329
PhosphoSitePlusiP61329

Expressioni

Gene expression databases

BgeeiENSMUSG00000022523 Expressed in 215 organ(s), highest expression level in olfactory bulb
CleanExiMM_FGF12
GenevisibleiP61329 MM

Interactioni

Subunit structurei

Interacts with the C-terminal region of SCN9A.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000097601

Structurei

3D structure databases

ProteinModelPortaliP61329
SMRiP61329
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi11 – 38Bipartite nuclear localization signalSequence analysisAdd BLAST28

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3885 Eukaryota
ENOG4111IPH LUCA
GeneTreeiENSGT00760000118859
HOGENOMiHOG000290676
HOVERGENiHBG007580
InParanoidiP61329
KOiK22413
OMAiYSSEVFT
OrthoDBiEOG091G0NAY
PhylomeDBiP61329
TreeFamiTF330751

Family and domain databases

CDDicd00058 FGF, 1 hit
InterProiView protein in InterPro
IPR028254 FGF12
IPR002209 Fibroblast_GF_fam
IPR008996 IL1/FGF
PANTHERiPTHR11486 PTHR11486, 1 hit
PTHR11486:SF17 PTHR11486:SF17, 1 hit
PfamiView protein in Pfam
PF00167 FGF, 1 hit
PRINTSiPR00263 HBGFFGF
SMARTiView protein in SMART
SM00442 FGF, 1 hit
SUPFAMiSSF50353 SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247 HBGF_FGF, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P61329-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS
60 70 80 90 100
KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN
110 120 130 140 150
SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES
160 170 180 190 200
VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP
210 220 230 240
KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST
Length:243
Mass (Da):27,399
Last modified:May 10, 2004 - v1
Checksum:i773ED10B5BDD033C
GO
Isoform 2 (identifier: P61329-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

Show »
Length:181
Mass (Da):20,424
Checksum:iE150D8758875C8B7
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A338P764A0A338P764_MOUSE
Fibroblast growth factor
Fgf12
171Annotation score:
A0A338P752A0A338P752_MOUSE
Fibroblast growth factor 12
Fgf12
115Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42E → D in AAB71607 (PubMed:9232594).Curated1
Sequence conflicti182Q → P in AAB71607 (PubMed:9232594).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0102231 – 66MAAAI…VRRRP → MESK in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66201 mRNA Translation: AAB18917.1
AF020738 mRNA Translation: AAB71607.1
AK034335 mRNA Translation: BAC28679.1
BC030485 mRNA Translation: AAH30485.1
CCDSiCCDS28092.1 [P61329-1]
RefSeqiNP_001263348.1, NM_001276419.2
NP_034329.1, NM_010199.4 [P61329-2]
NP_898887.1, NM_183064.5 [P61329-1]
UniGeneiMm.399969
Mm.7996
Mm.94153

Genome annotation databases

EnsembliENSMUST00000100024; ENSMUSP00000097601; ENSMUSG00000022523 [P61329-1]
ENSMUST00000232352; ENSMUSP00000155924; ENSMUSG00000022523 [P61329-2]
GeneIDi14167
KEGGimmu:14167
UCSCiuc007yvr.3 mouse [P61329-1]
uc007yvt.3 mouse [P61329-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66201 mRNA Translation: AAB18917.1
AF020738 mRNA Translation: AAB71607.1
AK034335 mRNA Translation: BAC28679.1
BC030485 mRNA Translation: AAH30485.1
CCDSiCCDS28092.1 [P61329-1]
RefSeqiNP_001263348.1, NM_001276419.2
NP_034329.1, NM_010199.4 [P61329-2]
NP_898887.1, NM_183064.5 [P61329-1]
UniGeneiMm.399969
Mm.7996
Mm.94153

3D structure databases

ProteinModelPortaliP61329
SMRiP61329
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000097601

PTM databases

iPTMnetiP61329
PhosphoSitePlusiP61329

Proteomic databases

MaxQBiP61329
PaxDbiP61329
PeptideAtlasiP61329
PRIDEiP61329

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000100024; ENSMUSP00000097601; ENSMUSG00000022523 [P61329-1]
ENSMUST00000232352; ENSMUSP00000155924; ENSMUSG00000022523 [P61329-2]
GeneIDi14167
KEGGimmu:14167
UCSCiuc007yvr.3 mouse [P61329-1]
uc007yvt.3 mouse [P61329-2]

Organism-specific databases

CTDi2257
MGIiMGI:109183 Fgf12

Phylogenomic databases

eggNOGiKOG3885 Eukaryota
ENOG4111IPH LUCA
GeneTreeiENSGT00760000118859
HOGENOMiHOG000290676
HOVERGENiHBG007580
InParanoidiP61329
KOiK22413
OMAiYSSEVFT
OrthoDBiEOG091G0NAY
PhylomeDBiP61329
TreeFamiTF330751

Enzyme and pathway databases

ReactomeiR-MMU-5576892 Phase 0 - rapid depolarisation

Miscellaneous databases

PROiPR:P61329
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022523 Expressed in 215 organ(s), highest expression level in olfactory bulb
CleanExiMM_FGF12
GenevisibleiP61329 MM

Family and domain databases

CDDicd00058 FGF, 1 hit
InterProiView protein in InterPro
IPR028254 FGF12
IPR002209 Fibroblast_GF_fam
IPR008996 IL1/FGF
PANTHERiPTHR11486 PTHR11486, 1 hit
PTHR11486:SF17 PTHR11486:SF17, 1 hit
PfamiView protein in Pfam
PF00167 FGF, 1 hit
PRINTSiPR00263 HBGFFGF
SMARTiView protein in SMART
SM00442 FGF, 1 hit
SUPFAMiSSF50353 SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247 HBGF_FGF, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFGF12_MOUSE
AccessioniPrimary (citable) accession number: P61329
Secondary accession number(s): O35339
, P70376, Q924B4, Q92912, Q93001
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: October 10, 2018
This is version 113 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again