Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P61328 (FGF12_HUMAN)

Entry version 158 (02 Dec 2020)
Sequence version 1 (10 May 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Fibroblast growth factor 12

Gene

FGF12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in nervous system development and function. Involved in the positive regulation of voltage-gated sodium channel activity. Promotes neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGrowth factor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P61328

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5576892, Phase 0 - rapid depolarisation

SIGNOR Signaling Network Open Resource

More...SIGNORi		P61328

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fibroblast growth factor 12
Short name:
FGF-12
Alternative name(s):
Fibroblast growth factor homologous factor 1
Short name:
FHF-1
Myocyte-activating factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FGF12
Synonyms:FGF12B, FHF1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000114279.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:3668, FGF12

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601513, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P61328

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Epileptic encephalopathy, early infantile, 47 (EIEE47)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of epileptic encephalopathy, a heterogeneous group of severe childhood onset epilepsies characterized by refractory seizures, neurodevelopmental impairment, and poor prognosis. Development is normal prior to seizure onset, after which cognitive and motor delays become apparent.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_076507114R → H in EIEE47; increased function in positive regulation of SCN8A voltage-dependent sodium channel activity. 1 PublicationCorresponds to variant dbSNP:rs886039903EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi114R → A: Gain of function, affects voltage dependence of SCN8A fast inactivation. 1 Publication1
Mutagenesisi114R → G: Gain of function, affects voltage dependence of SCN8A fast inactivation. 1 Publication1

Keywords - Diseasei

Disease mutation, Epilepsy

Organism-specific databases

DisGeNET

More...DisGeNETi		2257

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		FGF12

MalaCards human disease database

More...MalaCardsi		FGF12
MIMi617166, phenotype

Open Targets

More...OpenTargetsi		ENSG00000114279

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		442835, Undetermined early-onset epileptic encephalopathy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28108

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P61328, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FGF12

Domain mapping of disease mutations (DMDM)

More...DMDMi		47117683

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001476041 – 243Fibroblast growth factor 12Add BLAST243

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P61328

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P61328

PeptideAtlas

More...PeptideAtlasi		P61328

PRoteomics IDEntifications database

More...PRIDEi		P61328

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		57295 [P61328-1]
57296 [P61328-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P61328

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P61328

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000114279, Expressed in heart and 166 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P61328, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P61328, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000114279, Group enriched (adrenal gland, brain, heart muscle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the C-terminal region of SCN9A.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		108548, 70 interactors

Database of interacting proteins

More...DIPi		DIP-59850N

Protein interaction database and analysis system

More...IntActi		P61328, 21 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000413496

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P61328, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1243
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P61328

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P61328

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi11 – 38Bipartite nuclear localization signalSequence analysisAdd BLAST28

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the heparin-binding growth factors family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3885, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155929

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_081609_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P61328

Identification of Orthologs from Complete Genome Data

More...OMAi		FFLQMHP

Database of Orthologous Groups

More...OrthoDBi		1192273at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P61328

TreeFam database of animal gene trees

More...TreeFami		TF330751

Family and domain databases

Conserved Domains Database

More...CDDi		cd00058, FGF, 1 hit

Database of protein disorder

More...DisProti		DP02160 [P61328-2]

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028254, FGF12
IPR002209, Fibroblast_GF_fam
IPR008996, IL1/FGF

The PANTHER Classification System

More...PANTHERi		PTHR11486, PTHR11486, 1 hit
PTHR11486:SF17, PTHR11486:SF17, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00167, FGF, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00263, HBGFFGF

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00442, FGF, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50353, SSF50353, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00247, HBGF_FGF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P61328-1) [UniParc]FASTAAdd to basket
Also known as: FGF-12A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAIASSLI RQKRQARESN SDRVSASKRR SSPSKDGRSL CERHVLGVFS 
        60         70         80         90        100
KVRFCSGRKR PVRRRPEPQL KGIVTRLFSQ QGYFLQMHPD GTIDGTKDEN 
       110        120        130        140        150
SDYTLFNLIP VGLRVVAIQG VKASLYVAMN GEGYLYSSDV FTPECKFKES 
       160        170        180        190        200
VFENYYVIYS STLYRQQESG RAWFLGLNKE GQIMKGNRVK KTKPSSHFVP 
       210        220        230        240 
KPIEVCMYRE PSLHEIGEKQ GRSRKSSGTP TMNGGKVVNQ DST
Length:243
Mass (Da):27,399
Last modified:May 10, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i773ED10B5BDD033C
GO
Isoform 2 (identifier: P61328-2) [UniParc]FASTAAdd to basket
Also known as: FGF-12B

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRP → MESK

Show »
Length:181
Mass (Da):20,424
Checksum:iE150D8758875C8B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JEN8C9JEN8_HUMAN
Fibroblast growth factor
FGF12
144Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JIN3C9JIN3_HUMAN
Fibroblast growth factor
FGF12
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JUK8C9JUK8_HUMAN
Fibroblast growth factor
FGF12
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti190K → E in AAB18786 (PubMed:10049777).Curated1
Sequence conflicti211P → Q in AAH22524 (PubMed:15489334).Curated1
Sequence conflicti229 – 243TPTMN…NQDST → HHHDGGKL in AAB18786 (PubMed:10049777).CuratedAdd BLAST15

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_076507114R → H in EIEE47; increased function in positive regulation of SCN8A voltage-dependent sodium channel activity. 1 PublicationCorresponds to variant dbSNP:rs886039903EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0102221 – 66MAAAI…VRRRP → MESK in isoform 2. 3 PublicationsAdd BLAST66

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U66197 mRNA Translation: AAB18913.1
U76381 mRNA Translation: AAB18786.3
AK125307 mRNA Translation: BAG54181.1
AK313671 mRNA Translation: BAG36423.1
AK312513 mRNA Translation: BAG35414.1
CH471052 Genomic DNA Translation: EAW78084.1
BC022524 mRNA Translation: AAH22524.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3301.1 [P61328-1]
CCDS46983.1 [P61328-2]

Protein sequence database of the Protein Information Resource

More...PIRi		JG0184

NCBI Reference Sequences

More...RefSeqi		NP_004104.3, NM_004113.5 [P61328-2]
NP_066360.1, NM_021032.4 [P61328-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000445105; ENSP00000393686; ENSG00000114279 [P61328-2]
ENST00000450716; ENSP00000397635; ENSG00000114279 [P61328-2]
ENST00000454309; ENSP00000413496; ENSG00000114279 [P61328-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		2257

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:2257

UCSC genome browser

More...UCSCi		uc003fsx.4, human [P61328-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66197 mRNA Translation: AAB18913.1
U76381 mRNA Translation: AAB18786.3
AK125307 mRNA Translation: BAG54181.1
AK313671 mRNA Translation: BAG36423.1
AK312513 mRNA Translation: BAG35414.1
CH471052 Genomic DNA Translation: EAW78084.1
BC022524 mRNA Translation: AAH22524.1
CCDSiCCDS3301.1 [P61328-1]
CCDS46983.1 [P61328-2]
PIRiJG0184
RefSeqiNP_004104.3, NM_004113.5 [P61328-2]
NP_066360.1, NM_021032.4 [P61328-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Q1UX-ray1.70A67-206[»]
4JQ0X-ray3.84A1-243[»]
SMRiP61328
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi108548, 70 interactors
DIPiDIP-59850N
IntActiP61328, 21 interactors
STRINGi9606.ENSP00000413496

PTM databases

iPTMnetiP61328
PhosphoSitePlusiP61328

Polymorphism and mutation databases

BioMutaiFGF12
DMDMi47117683

Proteomic databases

MassIVEiP61328
PaxDbiP61328
PeptideAtlasiP61328
PRIDEiP61328
ProteomicsDBi57295 [P61328-1]
57296 [P61328-2]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		P61328, 1 sequenced antibody

Antibodypedia a portal for validated antibodies

More...Antibodypediai		33876, 226 antibodies

The DNASU plasmid repository

More...DNASUi		2257

Genome annotation databases

EnsembliENST00000445105; ENSP00000393686; ENSG00000114279 [P61328-2]
ENST00000450716; ENSP00000397635; ENSG00000114279 [P61328-2]
ENST00000454309; ENSP00000413496; ENSG00000114279 [P61328-1]
GeneIDi2257
KEGGihsa:2257
UCSCiuc003fsx.4, human [P61328-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		2257
DisGeNETi2257
EuPathDBiHostDB:ENSG00000114279.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		FGF12
GeneReviewsiFGF12
HGNCiHGNC:3668, FGF12
HPAiENSG00000114279, Group enriched (adrenal gland, brain, heart muscle)
MalaCardsiFGF12
MIMi601513, gene
617166, phenotype
neXtProtiNX_P61328
OpenTargetsiENSG00000114279
Orphaneti442835, Undetermined early-onset epileptic encephalopathy
PharmGKBiPA28108

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3885, Eukaryota
GeneTreeiENSGT00940000155929
HOGENOMiCLU_081609_2_0_1
InParanoidiP61328
OMAiFFLQMHP
OrthoDBi1192273at2759
PhylomeDBiP61328
TreeFamiTF330751

Enzyme and pathway databases

PathwayCommonsiP61328
ReactomeiR-HSA-5576892, Phase 0 - rapid depolarisation
SIGNORiP61328

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		2257, 4 hits in 845 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FGF12, human
EvolutionaryTraceiP61328

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FGF12

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		2257
PharosiP61328, Tbio

Protein Ontology

More...PROi		PR:P61328
RNActiP61328, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000114279, Expressed in heart and 166 other tissues
ExpressionAtlasiP61328, baseline and differential
GenevisibleiP61328, HS

Family and domain databases

CDDicd00058, FGF, 1 hit
DisProtiDP02160 [P61328-2]
InterProiView protein in InterPro
IPR028254, FGF12
IPR002209, Fibroblast_GF_fam
IPR008996, IL1/FGF
PANTHERiPTHR11486, PTHR11486, 1 hit
PTHR11486:SF17, PTHR11486:SF17, 1 hit
PfamiView protein in Pfam
PF00167, FGF, 1 hit
PRINTSiPR00263, HBGFFGF
SMARTiView protein in SMART
SM00442, FGF, 1 hit
SUPFAMiSSF50353, SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247, HBGF_FGF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFGF12_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P61328
Secondary accession number(s): B2R6B7
, B2R976, O35339, P70376, Q8TBG5, Q92912, Q93001
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: December 2, 2020
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again