Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein max

Gene

MAX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC:MAX complex is a transcriptional activator, whereas the MAD:MAX complex is a repressor. May repress transcription via the recruitment of a chromatin remodeling complex containing H3 'Lys-9' histone methyltransferase activity. Represses MYC transcriptional activity from E-box elements.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-69202 Cyclin E associated events during G1/S transition
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkiP61244
SIGNORiP61244

Names & Taxonomyi

Protein namesi
Recommended name:
Protein maxCurated
Alternative name(s):
Class D basic helix-loop-helix protein 4
Short name:
bHLHd4
Myc-associated factor XImported
Gene namesi
Name:MAXImported
Synonyms:BHLHD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000125952.18
HGNCiHGNC:6913 MAX
MIMi154950 gene
neXtProtiNX_P61244

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Nucleus

Pathology & Biotechi

Involvement in diseasei

Pheochromocytoma (PCC)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionA catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.
See also OMIM:171300
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0793479V → L in PCC; does not repress MYC transcriptional activity. 2 PublicationsCorresponds to variant dbSNP:rs201743423EnsemblClinVar.1
Natural variantiVAR_07934823D → N in PCC; unknown pathological significance; does not affect MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07934925R → W in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935033 – 160Missing in PCC; does not repress MYC transcriptional activity. 3 PublicationsAdd BLAST128
Natural variantiVAR_07935135R → C in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935247 – 52Missing in PCC; unknown pathological significance; somatic mutation. 1 Publication6
Natural variantiVAR_07935360R → W in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935471I → S in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935574M → V in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935675 – 160Missing in PCC; unknown pathological significance. 2 PublicationsAdd BLAST86
Natural variantiVAR_07935782 – 160Missing in PCC; unknown pathological significance. 1 PublicationAdd BLAST79
Natural variantiVAR_07935890R → P in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935994L → P in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_079360102L → P in PCC; does not repress MYC transcriptional activity. 2 Publications1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi66K → Q: Kept nuclear localization. Loss of nuclear localization; when associated with Q-153 and Q-154. 1 Publication1
Mutagenesisi66K → R: Loss of acetylation, kept nuclear localization; when associated with R-153 and R-154. 1 Publication1
Mutagenesisi153K → Q: Loss of nuclear localization; when associated with Q-66 and Q-154. Kept nuclear localization; when associated with Q-154. 1 Publication1
Mutagenesisi153K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-154. 1 Publication1
Mutagenesisi154K → Q: Loss of nuclear localization; when associated with Q-66 and Q-153. Kept nuclear localization; when associated with Q-153. 1 Publication1
Mutagenesisi154K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-153. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi4149
GeneReviewsiMAX
MalaCardsiMAX
MIMi171300 phenotype
OpenTargetsiENSG00000125952
Orphaneti29072 Hereditary pheochromocytoma-paraganglioma
PharmGKBiPA30656

Chemistry databases

ChEMBLiCHEMBL1250363

Polymorphism and mutation databases

DMDMi47117704

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001272692 – 160Protein maxAdd BLAST159
Isoform 2 (identifier: P61244-2)
Initiator methionineiRemovedCombined sources

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Modified residuei2PhosphoserineCombined sources1
Modified residuei11PhosphoserineCombined sources1
Modified residuei66N6-acetyllysine1 Publication1
Modified residuei107PhosphoserineCombined sources1
Modified residuei153N6-acetyllysine1 Publication1
Modified residuei154N6-acetyllysine1 Publication1
Isoform 2 (identifier: P61244-2)
Modified residuei2PhosphoserineCombined sources1
Modified residuei2N-acetylserineCombined sources1
Modified residuei11PhosphoserineCombined sources1

Post-translational modificationi

Reversible lysine acetylation might regulate the nuclear-cytoplasmic shuttling of specific Max complexes.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP61244
MaxQBiP61244
PaxDbiP61244
PeptideAtlasiP61244
PRIDEiP61244
ProteomicsDBi57281
57282 [P61244-2]
57283 [P61244-3]
57284 [P61244-4]
57285 [P61244-5]

PTM databases

iPTMnetiP61244
PhosphoSitePlusiP61244

Miscellaneous databases

PMAP-CutDBiP61244

Expressioni

Tissue specificityi

High levels found in the brain, heart and lung while lower levels are seen in the liver, kidney and skeletal muscle.

Gene expression databases

BgeeiENSG00000125952 Expressed in 240 organ(s), highest expression level in blood
CleanExiHS_MAX
ExpressionAtlasiP61244 baseline and differential
GenevisibleiP61244 HS

Organism-specific databases

HPAiCAB000328
HPA003474

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MYC or MAD. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with SPAG9. The heterodimer MYC:MAX interacts with ABI1; the interaction may enhance MYC:MAX transcriptional activity.2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110319, 151 interactors
ComplexPortaliCPX-104 Transcriptional repressor Mad-Max complex
CPX-91 Transcriptional activator Myc-Max complex
CORUMiP61244
DIPiDIP-28145N
IntActiP61244, 100 interactors
MINTiP61244
STRINGi9606.ENSP00000351490

Chemistry databases

BindingDBiP61244

Structurei

Secondary structure

1160
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

DisProtiDP00084
DP01097
ProteinModelPortaliP61244
SMRiP61244
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61244

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 74bHLHPROSITE-ProRule annotationAdd BLAST52

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni81 – 102Leucine-zipperAdd BLAST22

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi152 – 156Nuclear localization signal5

Sequence similaritiesi

Belongs to the MAX family.Curated

Phylogenomic databases

eggNOGiKOG2483 Eukaryota
ENOG4111V1C LUCA
GeneTreeiENSGT00530000064011
HOGENOMiHOG000293257
HOVERGENiHBG008542
InParanoidiP61244
KOiK04453
OMAiRHTSTAN
OrthoDBiEOG091G1312
PhylomeDBiP61244
TreeFamiTF318841

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR037933 MAX
PANTHERiPTHR10328 PTHR10328, 1 hit
PfamiView protein in Pfam
PF00010 HLH, 1 hit
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P61244-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV
60 70 80 90 100
PSLQGEKASR AQILDKATEY IQYMRRKNHT HQQDIDDLKR QNALLEQQVR
110 120 130 140 150
ALEKARSSAQ LQTNYPSSDN SLYTNAKGST ISAFDGGSDS SSESEPEEPQ
160
SRKKLRMEAS
Length:160
Mass (Da):18,275
Last modified:May 10, 2004 - v1
Checksum:iEB10F3137727A56F
GO
Isoform 2 (identifier: P61244-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     13-21: Missing.

Show »
Length:151
Mass (Da):17,202
Checksum:iCB69F6F5F39793FA
GO
Isoform 3 (identifier: P61244-3) [UniParc] [UniParc]FASTAAdd to basket
Also known as: Delta-Max

The sequence of this isoform differs from the canonical sequence as follows:
     99-160: VRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS → GESES

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:103
Mass (Da):12,099
Checksum:i49DC1A0441FFA301
GO
Isoform 4 (identifier: P61244-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     99-160: VRALEKARSS...SRKKLRMEAS → GEHPSSWGSW...VRASHGVCAQ

Show »
Length:134
Mass (Da):15,395
Checksum:iA2FFD0B98CF93275
GO
Isoform 5 (identifier: P61244-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-160: ASRAQILDKA...SRKKLRMEAS → LYFLFWKLCT...QVHKKKECKI

Note: No experimental confirmation available.
Show »
Length:96
Mass (Da):11,455
Checksum:iD380F721DCF2D6C8
GO
Isoform 6 (identifier: P61244-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-160: ASRAQILDKA...SRKKLRMEAS → GTKMKLTLPPVFPYEHLPFPTVFCHG

Note: No experimental confirmation available.
Show »
Length:83
Mass (Da):9,599
Checksum:iFE0E966237003D47
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6V3B1Q6V3B1_HUMAN
MAX protein
MAX
94Annotation score:
G3V563G3V563_HUMAN
Protein max
MAX
121Annotation score:
G3V2R5G3V2R5_HUMAN
Protein max
MAX
125Annotation score:
G3V5L1G3V5L1_HUMAN
Protein max
MAX
124Annotation score:
G3V570G3V570_HUMAN
Protein max
MAX
43Annotation score:
G3V302G3V302_HUMAN
Protein max
MAX
97Annotation score:
G3V2N4G3V2N4_HUMAN
Protein max
MAX
82Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0793479V → L in PCC; does not repress MYC transcriptional activity. 2 PublicationsCorresponds to variant dbSNP:rs201743423EnsemblClinVar.1
Natural variantiVAR_07934823D → N in PCC; unknown pathological significance; does not affect MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07934925R → W in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935033 – 160Missing in PCC; does not repress MYC transcriptional activity. 3 PublicationsAdd BLAST128
Natural variantiVAR_07935135R → C in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935247 – 52Missing in PCC; unknown pathological significance; somatic mutation. 1 Publication6
Natural variantiVAR_07935360R → W in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935471I → S in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935574M → V in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935675 – 160Missing in PCC; unknown pathological significance. 2 PublicationsAdd BLAST86
Natural variantiVAR_07935782 – 160Missing in PCC; unknown pathological significance. 1 PublicationAdd BLAST79
Natural variantiVAR_07935890R → P in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_07935994L → P in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_079360102L → P in PCC; does not repress MYC transcriptional activity. 2 Publications1
Natural variantiVAR_079361114N → T Polymorphism; does not affect MYC transcriptional activity. 1 PublicationCorresponds to variant dbSNP:rs772912674EnsemblClinVar.1
Natural variantiVAR_079362142S → L Polymorphism; does not affect MYC transcriptional activity. 2 PublicationsCorresponds to variant dbSNP:rs760147253EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00211713 – 21Missing in isoform 2. 3 Publications9
Alternative sequenceiVSP_04343058 – 160ASRAQ…RMEAS → LYFLFWKLCTPVLHRQSLMQ KCHTFISSYQVHKKKECKI in isoform 5. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_04766158 – 160ASRAQ…RMEAS → GTKMKLTLPPVFPYEHLPFP TVFCHG in isoform 6. CuratedAdd BLAST103
Alternative sequenceiVSP_00211899 – 160VRALE…RMEAS → GESES in isoform 3. 2 PublicationsAdd BLAST62
Alternative sequenceiVSP_04318399 – 160VRALE…RMEAS → GEHPSSWGSWPCCAPARSGF GTWACRVRASHGVCAQ in isoform 4. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64240 mRNA Translation: AAA36200.1
M64240 mRNA Translation: AAA36201.1
X66867 Genomic DNA Translation: CAA47337.1
X66867 Genomic DNA Translation: CAA47338.1
X66867 Genomic DNA Translation: CAA47339.1
X60287 mRNA Translation: CAA42827.1
AK290130 mRNA Translation: BAF82819.1
AK290929 mRNA Translation: BAF83618.1
AK292189 mRNA Translation: BAF84878.1
AK292630 mRNA Translation: BAF85319.1
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80899.1
CH471061 Genomic DNA Translation: EAW80901.1
CH471061 Genomic DNA Translation: EAW80903.1
CH471061 Genomic DNA Translation: EAW80904.1
BC003525 mRNA Translation: AAH03525.1
BC004516 mRNA Translation: AAH04516.1
BC013669 mRNA Translation: AAH13669.1
BC027924 mRNA Translation: AAH27924.1
CCDSiCCDS41965.1 [P61244-3]
CCDS9770.1 [P61244-6]
CCDS9771.1
CCDS9772.1 [P61244-2]
CCDS9774.1 [P61244-5]
PIRiA38431
A42611
B38431
S33118
RefSeqiNP_001257997.1, NM_001271068.1
NP_002373.3, NM_002382.4 [P61244-1]
NP_660087.1, NM_145112.2 [P61244-2]
NP_660088.1, NM_145113.2 [P61244-3]
NP_660089.1, NM_145114.2 [P61244-5]
NP_932061.1, NM_197957.3 [P61244-6]
UniGeneiHs.285354

Genome annotation databases

EnsembliENST00000246163; ENSP00000246163; ENSG00000125952 [P61244-5]
ENST00000284165; ENSP00000284165; ENSG00000125952 [P61244-4]
ENST00000341653; ENSP00000342482; ENSG00000125952 [P61244-6]
ENST00000358402; ENSP00000351175; ENSG00000125952 [P61244-2]
ENST00000358664; ENSP00000351490; ENSG00000125952 [P61244-1]
ENST00000394606; ENSP00000378104; ENSG00000125952 [P61244-3]
ENST00000553928; ENSP00000451907; ENSG00000125952 [P61244-3]
ENST00000556979; ENSP00000452378; ENSG00000125952 [P61244-3]
ENST00000618858; ENSP00000480127; ENSG00000125952 [P61244-3]
GeneIDi4149
KEGGihsa:4149
UCSCiuc001xic.3 human

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64240 mRNA Translation: AAA36200.1
M64240 mRNA Translation: AAA36201.1
X66867 Genomic DNA Translation: CAA47337.1
X66867 Genomic DNA Translation: CAA47338.1
X66867 Genomic DNA Translation: CAA47339.1
X60287 mRNA Translation: CAA42827.1
AK290130 mRNA Translation: BAF82819.1
AK290929 mRNA Translation: BAF83618.1
AK292189 mRNA Translation: BAF84878.1
AK292630 mRNA Translation: BAF85319.1
AL139022 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW80899.1
CH471061 Genomic DNA Translation: EAW80901.1
CH471061 Genomic DNA Translation: EAW80903.1
CH471061 Genomic DNA Translation: EAW80904.1
BC003525 mRNA Translation: AAH03525.1
BC004516 mRNA Translation: AAH04516.1
BC013669 mRNA Translation: AAH13669.1
BC027924 mRNA Translation: AAH27924.1
CCDSiCCDS41965.1 [P61244-3]
CCDS9770.1 [P61244-6]
CCDS9771.1
CCDS9772.1 [P61244-2]
CCDS9774.1 [P61244-5]
PIRiA38431
A42611
B38431
S33118
RefSeqiNP_001257997.1, NM_001271068.1
NP_002373.3, NM_002382.4 [P61244-1]
NP_660087.1, NM_145112.2 [P61244-2]
NP_660088.1, NM_145113.2 [P61244-3]
NP_660089.1, NM_145114.2 [P61244-5]
NP_932061.1, NM_197957.3 [P61244-6]
UniGeneiHs.285354

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AN2X-ray2.90A22-107[»]
1HLOX-ray2.80A/B4-92[»]
1NKPX-ray1.80B/E23-102[»]
1NLWX-ray2.00B/E24-99[»]
1R05NMR-A/B22-103[»]
5EYOX-ray2.39A/C22-107[»]
DisProtiDP00084
DP01097
ProteinModelPortaliP61244
SMRiP61244
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110319, 151 interactors
ComplexPortaliCPX-104 Transcriptional repressor Mad-Max complex
CPX-91 Transcriptional activator Myc-Max complex
CORUMiP61244
DIPiDIP-28145N
IntActiP61244, 100 interactors
MINTiP61244
STRINGi9606.ENSP00000351490

Chemistry databases

BindingDBiP61244
ChEMBLiCHEMBL1250363

PTM databases

iPTMnetiP61244
PhosphoSitePlusiP61244

Polymorphism and mutation databases

DMDMi47117704

Proteomic databases

EPDiP61244
MaxQBiP61244
PaxDbiP61244
PeptideAtlasiP61244
PRIDEiP61244
ProteomicsDBi57281
57282 [P61244-2]
57283 [P61244-3]
57284 [P61244-4]
57285 [P61244-5]

Protocols and materials databases

DNASUi4149
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000246163; ENSP00000246163; ENSG00000125952 [P61244-5]
ENST00000284165; ENSP00000284165; ENSG00000125952 [P61244-4]
ENST00000341653; ENSP00000342482; ENSG00000125952 [P61244-6]
ENST00000358402; ENSP00000351175; ENSG00000125952 [P61244-2]
ENST00000358664; ENSP00000351490; ENSG00000125952 [P61244-1]
ENST00000394606; ENSP00000378104; ENSG00000125952 [P61244-3]
ENST00000553928; ENSP00000451907; ENSG00000125952 [P61244-3]
ENST00000556979; ENSP00000452378; ENSG00000125952 [P61244-3]
ENST00000618858; ENSP00000480127; ENSG00000125952 [P61244-3]
GeneIDi4149
KEGGihsa:4149
UCSCiuc001xic.3 human

Organism-specific databases

CTDi4149
DisGeNETi4149
EuPathDBiHostDB:ENSG00000125952.18
GeneCardsiMAX
GeneReviewsiMAX
HGNCiHGNC:6913 MAX
HPAiCAB000328
HPA003474
MalaCardsiMAX
MIMi154950 gene
171300 phenotype
neXtProtiNX_P61244
OpenTargetsiENSG00000125952
Orphaneti29072 Hereditary pheochromocytoma-paraganglioma
PharmGKBiPA30656
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2483 Eukaryota
ENOG4111V1C LUCA
GeneTreeiENSGT00530000064011
HOGENOMiHOG000293257
HOVERGENiHBG008542
InParanoidiP61244
KOiK04453
OMAiRHTSTAN
OrthoDBiEOG091G1312
PhylomeDBiP61244
TreeFamiTF318841

Enzyme and pathway databases

ReactomeiR-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex
R-HSA-69202 Cyclin E associated events during G1/S transition
R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry
R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkiP61244
SIGNORiP61244

Miscellaneous databases

ChiTaRSiMAX human
EvolutionaryTraceiP61244
GeneWikiiMAX_(gene)
GenomeRNAii4149
PMAP-CutDBiP61244
PROiPR:P61244
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125952 Expressed in 240 organ(s), highest expression level in blood
CleanExiHS_MAX
ExpressionAtlasiP61244 baseline and differential
GenevisibleiP61244 HS

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR037933 MAX
PANTHERiPTHR10328 PTHR10328, 1 hit
PfamiView protein in Pfam
PF00010 HLH, 1 hit
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMAX_HUMAN
AccessioniPrimary (citable) accession number: P61244
Secondary accession number(s): A6NH73
, A8K265, A8K4G4, A8K824, P25912, P52163, Q14803, Q96CY8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: September 12, 2018
This is version 172 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again