MAX

Functionⁱ

Transcription regulator. Forms a sequence-specific DNA-binding protein complex with MYC or MAD which recognizes the core sequence 5'-CAC[GA]TG-3'. The MYC:MAX complex is a transcriptional activator, whereas the MAD:MAX complex is a repressor. May repress transcription via the recruitment of a chromatin remodeling complex containing H3 'Lys-9' histone methyltransferase activity. Represses MYC transcriptional activity from E-box elements.1 Publication

GO - Molecular functionⁱ

DNA binding
Source: CAFA
Inferred from mutant phenotypeⁱ
- 9399572
DNA-binding transcription factor activity
Source: ProtInc
Traceable author statementⁱ
- 2006410
E-box binding
Source: CAFA
Inferred from mutant phenotypeⁱ
- 16171389
protein-containing complex binding Source: Ensembl
protein heterodimerization activity Source: Ensembl
protein homodimerization activity
Source: CAFA
Inferred from mutant phenotypeⁱ
- 16171389
- 9399572
RNA polymerase II transcription factor activity, sequence-specific DNA binding Source: NTNU_SB
transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA binding
Source: UniProtKB
Inferred from direct assayⁱ
- 26070438
transcription coactivator activity
Source: ProtInc
Traceable author statementⁱ
- 2006410
transcription coregulator activity
Source: ProtInc
Traceable author statementⁱ
- 8425218

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular response to peptide hormone stimulus Source: Ensembl
cellular response to starvation Source: Ensembl
G1/S transition of mitotic cell cycle Source: Reactome
negative regulation of G0 to G1 transition Source: Reactome
negative regulation of transcription by RNA polymerase II
Source: NTNU_SB
Inferred from direct assayⁱ
- 8521822
neuron apoptotic process Source: Ensembl
protein-containing complex assembly Source: Ensembl
response to axon injury Source: Ensembl
response to insulin Source: Ensembl
retina development in camera-type eye Source: Ensembl
transcription by RNA polymerase II
Source: ProtInc
Traceable author statementⁱ
- 8425218

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Activator, DNA-binding, Repressor
Biological process	Transcription, Transcription regulation

Enzyme and pathway databases

Reactomeⁱ	R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex R-HSA-69202 Cyclin E associated events during G1/S transition R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkⁱ	P61244
SIGNORⁱ	P61244

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Protein maxCurated Alternative name(s): Class D basic helix-loop-helix protein 4 Short name: bHLHd4 Myc-associated factor XImported
Gene namesⁱ	Name:MAXImported Synonyms:BHLHD4
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 14

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000125952.18
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:6913 MAX
MIMⁱ	154950 gene
neXtProtⁱ	NX_P61244

Keywords - Cellular componentⁱ

Cell projection, Nucleus

Pathology & Biotechⁱ

Involvement in diseaseⁱ

Pheochromocytoma (PCC)3 Publications

Disease susceptibility is associated with variations affecting the gene represented in this entry.

Disease descriptionA catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	66	K → Q: Kept nuclear localization. Loss of nuclear localization; when associated with Q-153 and Q-154. 1 Publication	1
Mutagenesisⁱ	66	K → R: Loss of acetylation, kept nuclear localization; when associated with R-153 and R-154. 1 Publication	1
Mutagenesisⁱ	153	K → Q: Loss of nuclear localization; when associated with Q-66 and Q-154. Kept nuclear localization; when associated with Q-154. 1 Publication	1
Mutagenesisⁱ	153	K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-154. 1 Publication	1
Mutagenesisⁱ	154	K → Q: Loss of nuclear localization; when associated with Q-66 and Q-153. Kept nuclear localization; when associated with Q-153. 1 Publication	1
Mutagenesisⁱ	154	K → R: Loss of acetylation, kept nuclear localization; when associated with R-66 and R-153. 1 Publication	1

Keywords - Diseaseⁱ

Disease mutation

Organism-specific databases

DisGeNET More...DisGeNETⁱ	4149
GeneReviewsⁱ	MAX
MalaCards human disease database More...MalaCardsⁱ	MAX
MIMⁱ	171300 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000125952
Orphanetⁱ	29072 Hereditary pheochromocytoma-paraganglioma
PharmGKBⁱ	PA30656

Chemistry databases

ChEMBLⁱ	CHEMBL1250363

ChEMBLⁱ

CHEMBL1250363

Polymorphism and mutation databases

DMDMⁱ	47117704

DMDMⁱ

47117704

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000127269	2 – 160	Protein maxAdd BLAST	159
Isoform 2 (identifier: P61244-2)
Initiator methionineⁱ		RemovedCombined sources

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylserineCombined sources	1
Modified residueⁱ	2	PhosphoserineCombined sources	1
Modified residueⁱ	11	PhosphoserineCombined sources	1
Modified residueⁱ	66	N6-acetyllysine1 Publication	1
Modified residueⁱ	107	PhosphoserineCombined sources	1
Modified residueⁱ	153	N6-acetyllysine1 Publication	1
Modified residueⁱ	154	N6-acetyllysine1 Publication	1
Isoform 2 (identifier: P61244-2)
Modified residueⁱ	2	PhosphoserineCombined sources	1
Modified residueⁱ	2	N-acetylserineCombined sources	1
Modified residueⁱ	11	PhosphoserineCombined sources	1

Post-translational modificationⁱ

Reversible lysine acetylation might regulate the nuclear-cytoplasmic shuttling of specific Max complexes.1 Publication

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	P61244
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P61244
PaxDbⁱ	P61244
PeptideAtlas More...PeptideAtlasⁱ	P61244
PRIDEⁱ	P61244
ProteomicsDBⁱ	57281 57282 [P61244-2] 57283 [P61244-3] 57284 [P61244-4] 57285 [P61244-5]

PTM databases

iPTMnetⁱ	P61244
PhosphoSitePlusⁱ	P61244

Miscellaneous databases

PMAP-CutDBⁱ	P61244

PMAP-CutDBⁱ

P61244

Expressionⁱ

Tissue specificityⁱ

High levels found in the brain, heart and lung while lower levels are seen in the liver, kidney and skeletal muscle.

Gene expression databases

Bgeeⁱ	ENSG00000125952 Expressed in 240 organ(s), highest expression level in blood
CleanExⁱ	HS_MAX
ExpressionAtlasⁱ	P61244 baseline and differential
Genevisibleⁱ	P61244 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB000328 HPA003474

HPAⁱ

CAB000328
HPA003474

Interactionⁱ

Subunit structureⁱ

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MYC or MAD. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2, MBLR, L3MBTL2 and YAF2. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with SPAG9. The heterodimer MYC:MAX interacts with ABI1; the interaction may enhance MYC:MAX transcriptional activity.2 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
BANP	Q8N9N5	3	EBI-751711,EBI-744695
E2F6	O75461	4	EBI-751711,EBI-749694
EEF1D	P29692	2	EBI-751711,EBI-358607
EPAS1	Q99814	2	EBI-751711,EBI-447470
FOXK2	Q01167	4	EBI-751711,EBI-2509991
FTH1	P02794	2	EBI-751711,EBI-713259
GABBR1	Q9UBS5	3	EBI-751711,EBI-724156
H2AFY	O75367	2	EBI-751711,EBI-2868511
L3MBTL2	Q969R5	5	EBI-751711,EBI-739909
LIG3	P49916	2	EBI-751711,EBI-1753381
MECP2	P51608	2	EBI-751711,EBI-1189067
MGA	Q8IWI9	4	EBI-751711,EBI-2815196
MXD1	Q05195	3	EBI-751711,EBI-8833637
MXI1	P50539	6	EBI-751711,EBI-752241
MYC	P01106	33	EBI-751711,EBI-447544
MYCN	P04198	10	EBI-751711,EBI-878369
PLEKHF2	Q9H8W4	3	EBI-751711,EBI-742388
TFAP2A	P05549	2	EBI-751711,EBI-347351
TFDP1	Q14186	4	EBI-751711,EBI-749713
UNC45A	Q9H3U1	3	EBI-10218525,EBI-1048763
VRK3	Q8IV63	2	EBI-751711,EBI-1058605
XRCC1	P18887	2	EBI-751711,EBI-947466

GO - Molecular functionⁱ

protein heterodimerization activity Source: Ensembl
protein homodimerization activity
Source: CAFA
Inferred from mutant phenotypeⁱ
- 16171389
- 9399572

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	110319, 151 interactors
ComplexPortalⁱ	CPX-104 Transcriptional repressor Mad-Max complex CPX-91 Transcriptional activator Myc-Max complex
CORUMⁱ	P61244
Database of interacting proteins More...DIPⁱ	DIP-28145N
IntActⁱ	P61244, 100 interactors
Molecular INTeraction database More...MINTⁱ	P61244
STRINGⁱ	9606.ENSP00000351490

Chemistry databases

BindingDBⁱ

P61244

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	5 – 9	Combined sources	5
Helixⁱ	24 – 47	Combined sources	24
Helixⁱ	51 – 53	Combined sources	3
Helixⁱ	60 – 100	Combined sources	41

Show more details

3D structure databases

Database of protein disorder More...DisProtⁱ	DP00084 DP01097
ProteinModelPortalⁱ	P61244
SMRⁱ	P61244
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P61244

EvolutionaryTraceⁱ

P61244

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	23 – 74	bHLHPROSITE-ProRule annotationAdd BLAST		52

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	81 – 102	Leucine-zipperAdd BLAST		22

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	152 – 156	Nuclear localization signal		5

Sequence similaritiesⁱ

Belongs to the MAX family.Curated

Phylogenomic databases

eggNOGⁱ	KOG2483 Eukaryota ENOG4111V1C LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000064011
HOGENOMⁱ	HOG000293257
HOVERGENⁱ	HBG008542
InParanoidⁱ	P61244
KEGG Orthology (KO) More...KOⁱ	K04453
OMAⁱ	RHTSTAN
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G1312
PhylomeDBⁱ	P61244
TreeFamⁱ	TF318841

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00083 HLH, 1 hit
Gene3Dⁱ	4.10.280.10, 1 hit
InterProⁱ	View protein in InterPro IPR011598 bHLH_dom IPR036638 HLH_DNA-bd_sf IPR037933 MAX
PANTHERⁱ	PTHR10328 PTHR10328, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00010 HLH, 1 hit
SMARTⁱ	View protein in SMART SM00353 HLH, 1 hit
SUPFAMⁱ	SSF47459 SSF47459, 1 hit
PROSITEⁱ	View protein in PROSITE PS50888 BHLH, 1 hit

Sequences (6+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsⁱ produced by alternative splicing. Align Add to basket

Note: Additional isoforms seem to exist.

This entry has 6 described isoforms and 7 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: P61244-1) [UniParc]FASTA Add to basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV 
        60         70         80         90        100
PSLQGEKASR AQILDKATEY IQYMRRKNHT HQQDIDDLKR QNALLEQQVR 
       110        120        130        140        150
ALEKARSSAQ LQTNYPSSDN SLYTNAKGST ISAFDGGSDS SSESEPEEPQ 
       160
SRKKLRMEAS

Length:160

Mass (Da):18,275

Last modified:May 10, 2004 - v1

Checksum:ⁱEB10F3137727A56F

GO

Isoform 2 (identifier: P61244-2) [UniParc] [UniParc]FASTA Add to basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
13-21: Missing.

« Hide

        10         20         30         40         50
MSDNDDIEVE SDADKRAHHN ALERKRRDHI KDSFHSLRDS VPSLQGEKAS 
        60         70         80         90        100
RAQILDKATE YIQYMRRKNH THQQDIDDLK RQNALLEQQV RALEKARSSA 
       110        120        130        140        150
QLQTNYPSSD NSLYTNAKGS TISAFDGGSD SSSESEPEEP QSRKKLRMEA 

S

Show »

Length:151

Mass (Da):17,202

Checksum:ⁱCB69F6F5F39793FA

GO

Isoform 3 (identifier: P61244-3) [UniParc] [UniParc]FASTA Add to basket

Also known as: Delta-Max

The sequence of this isoform differs from the canonical sequence as follows:
99-160: VRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS → GESES

« Hide

        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV 
        60         70         80         90        100
PSLQGEKASR AQILDKATEY IQYMRRKNHT HQQDIDDLKR QNALLEQQGE 

SES

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »

Length:103

Mass (Da):12,099

Checksum:ⁱ49DC1A0441FFA301

GO

Isoform 4 (identifier: P61244-4) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
99-160: VRALEKARSS...SRKKLRMEAS → GEHPSSWGSW...VRASHGVCAQ

« Hide

        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV 
        60         70         80         90        100
PSLQGEKASR AQILDKATEY IQYMRRKNHT HQQDIDDLKR QNALLEQQGE 
       110        120        130 
HPSSWGSWPC CAPARSGFGT WACRVRASHG VCAQ

Show »

Length:134

Mass (Da):15,395

Checksum:ⁱA2FFD0B98CF93275

GO

Isoform 5 (identifier: P61244-5) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
58-160: ASRAQILDKA...SRKKLRMEAS → LYFLFWKLCT...QVHKKKECKI

« Hide

        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV 
        60         70         80         90 
PSLQGEKLYF LFWKLCTPVL HRQSLMQKCH TFISSYQVHK KKECKI

Note: No experimental confirmation available.

Show »

Length:96

Mass (Da):11,455

Checksum:ⁱD380F721DCF2D6C8

GO

Isoform 6 (identifier: P61244-6) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
58-160: ASRAQILDKA...SRKKLRMEAS → GTKMKLTLPPVFPYEHLPFPTVFCHG

« Hide

        10         20         30         40         50
MSDNDDIEVE SDEEQPRFQS AADKRAHHNA LERKRRDHIK DSFHSLRDSV 
        60         70         80 
PSLQGEKGTK MKLTLPPVFP YEHLPFPTVF CHG

Note: No experimental confirmation available.

Show »

Length:83

Mass (Da):9,599

Checksum:ⁱFE0E966237003D47

GO

Computationally mapped potential isoform sequencesⁱ

There are 7 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

Q6V3B1	Q6V3B1_HUMAN	MAX protein MAX protein (Protein max)	MAX	94	Annotation score:
G3V563	G3V563_HUMAN	Protein max Protein max	MAX	121	Annotation score:
G3V2R5	G3V2R5_HUMAN	Protein max Protein max	MAX	125	Annotation score:
G3V5L1	G3V5L1_HUMAN	Protein max Protein max	MAX	124	Annotation score:
G3V570	G3V570_HUMAN	Protein max Protein max	MAX	43	Annotation score:
G3V302	G3V302_HUMAN	Protein max Protein max	MAX	97	Annotation score:
G3V2N4	G3V2N4_HUMAN	Protein max Protein max	MAX	82	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_079347	9	V → L in PCC; does not repress MYC transcriptional activity. 2 PublicationsCorresponds to variant dbSNP:rs201743423EnsemblClinVar.	1
Natural variantⁱVAR_079348	23	D → N in PCC; unknown pathological significance; does not affect MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079349	25	R → W in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079350	33 – 160	Missing in PCC; does not repress MYC transcriptional activity. 3 PublicationsAdd BLAST	128
Natural variantⁱVAR_079351	35	R → C in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079352	47 – 52	Missing in PCC; unknown pathological significance; somatic mutation. 1 Publication	6
Natural variantⁱVAR_079353	60	R → W in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079354	71	I → S in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079355	74	M → V in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079356	75 – 160	Missing in PCC; unknown pathological significance. 2 PublicationsAdd BLAST	86
Natural variantⁱVAR_079357	82 – 160	Missing in PCC; unknown pathological significance. 1 PublicationAdd BLAST	79
Natural variantⁱVAR_079358	90	R → P in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079359	94	L → P in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079360	102	L → P in PCC; does not repress MYC transcriptional activity. 2 Publications	1
Natural variantⁱVAR_079361	114	N → T Polymorphism; does not affect MYC transcriptional activity. 1 PublicationCorresponds to variant dbSNP:rs772912674EnsemblClinVar.	1
Natural variantⁱVAR_079362	142	S → L Polymorphism; does not affect MYC transcriptional activity. 2 PublicationsCorresponds to variant dbSNP:rs760147253EnsemblClinVar.	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Length
Alternative sequenceⁱVSP_002117	13 – 21	Missing in isoform 2. 3 Publications	9
Alternative sequenceⁱVSP_043430	58 – 160	ASRAQ…RMEAS → LYFLFWKLCTPVLHRQSLMQ KCHTFISSYQVHKKKECKI in isoform 5. 1 PublicationAdd BLAST	103
Alternative sequenceⁱVSP_047661	58 – 160	ASRAQ…RMEAS → GTKMKLTLPPVFPYEHLPFP TVFCHG in isoform 6. CuratedAdd BLAST	103
Alternative sequenceⁱVSP_002118	99 – 160	VRALE…RMEAS → GESES in isoform 3. 2 PublicationsAdd BLAST	62
Alternative sequenceⁱVSP_043183	99 – 160	VRALE…RMEAS → GEHPSSWGSWPCCAPARSGF GTWACRVRASHGVCAQ in isoform 4. 1 PublicationAdd BLAST	62

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M64240 mRNA Translation: AAA36200.1 M64240 mRNA Translation: AAA36201.1 X66867 Genomic DNA Translation: CAA47337.1 X66867 Genomic DNA Translation: CAA47338.1 X66867 Genomic DNA Translation: CAA47339.1 X60287 mRNA Translation: CAA42827.1 AK290130 mRNA Translation: BAF82819.1 AK290929 mRNA Translation: BAF83618.1 AK292189 mRNA Translation: BAF84878.1 AK292630 mRNA Translation: BAF85319.1 AL139022 Genomic DNA No translation available. CH471061 Genomic DNA Translation: EAW80899.1 CH471061 Genomic DNA Translation: EAW80901.1 CH471061 Genomic DNA Translation: EAW80903.1 CH471061 Genomic DNA Translation: EAW80904.1 BC003525 mRNA Translation: AAH03525.1 BC004516 mRNA Translation: AAH04516.1 BC013669 mRNA Translation: AAH13669.1 BC027924 mRNA Translation: AAH27924.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS41965.1 [P61244-3] CCDS9770.1 [P61244-6] CCDS9771.1 CCDS9772.1 [P61244-2] CCDS9774.1 [P61244-5]
PIRⁱ	A38431 A42611 B38431 S33118
NCBI Reference Sequences More...RefSeqⁱ	NP_001257997.1, NM_001271068.1 NP_002373.3, NM_002382.4 [P61244-1] NP_660087.1, NM_145112.2 [P61244-2] NP_660088.1, NM_145113.2 [P61244-3] NP_660089.1, NM_145114.2 [P61244-5] NP_932061.1, NM_197957.3 [P61244-6]
UniGeneⁱ	Hs.285354

Genome annotation databases

Ensemblⁱ	ENST00000246163; ENSP00000246163; ENSG00000125952 [P61244-5] ENST00000284165; ENSP00000284165; ENSG00000125952 [P61244-4] ENST00000341653; ENSP00000342482; ENSG00000125952 [P61244-6] ENST00000358402; ENSP00000351175; ENSG00000125952 [P61244-2] ENST00000358664; ENSP00000351490; ENSG00000125952 [P61244-1] ENST00000394606; ENSP00000378104; ENSG00000125952 [P61244-3] ENST00000553928; ENSP00000451907; ENSG00000125952 [P61244-3] ENST00000556979; ENSP00000452378; ENSG00000125952 [P61244-3] ENST00000618858; ENSP00000480127; ENSG00000125952 [P61244-3]
GeneIDⁱ	4149
KEGGⁱ	hsa:4149
UCSC genome browser More...UCSCⁱ	uc001xic.3 human

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P61244	Protein max		FELCA		160	UniRef100_P61244
Protein max isoform a		CALJA		160
MAX isoform 7		PANTR		160
MYC associated factor X		MACMU		160
protein max isoform X1		Enhydra lutris kenyoni		160
+26
P61244-2	Protein max isoform b		CALJA		151	UniRef100_U3DBN1
MAX isoform 2		PANTR		151
MYC associated factor X		MACMU		151
Protein max		MACFA		151
Uncharacterized protein		PROCO		151
+23
P61244-3	MYC associated factor X, isoform CRA_d		HUMAN		103	UniRef100_A0A024R682
MAX isoform 13		PANTR		103
MAX isoform 13		PONAB		103
MYC associated factor X		SAIBB		103
Uncharacterized protein		CALJA		103
+8
P61244-4	MAX isoform 6		PONAB		134	UniRef100_A0A2J8WLY1
MAX isoform 6		PANTR		134
P61244-6	MAX isoform 1		PANTR		83	UniRef100_A0A2I3ST87
MYC associated factor X		GORGO		71

Protein	Similar proteins		Species	Score	Length	Source
P61244	Protein max		FELCA		160	UniRef90_P61244
Protein max		RAT		160
Protein max	)	MOUSE		160
Protein max isoform a		CALJA		160
MAX isoform 7		PANTR		160
+96
P61244-2	Isoform Short of Protein max		RAT		151	UniRef90_P52164-2
MYC associated factor X		PANTR		162
Uncharacterized protein		RABIT		160
Protein max		FELCA		158
Uncharacterized protein		MONDO		151
+70
P61244-3	MAX protein		HUMAN		94	UniRef90_Q6V3B1
Protein max isoform c		CALJA		94
MAX isoform 14		PONAB		94
MAX isoform 14		PANTR		94
MYC associated factor X		SAIBB		103
+23
P61244-4	Protein max		HUMAN		125	UniRef90_G3V2R5
MAX isoform 16		PONAB		125
MAX isoform 16		PANTR		125
Uncharacterized protein		PROCO		135
UPI000A3430D8		HETGA		115
+3
P61244-5	MYC associated factor X		SAIBB		104	UniRef90_P61244-5
Uncharacterized protein		Cebus capucinus imitator		104
Uncharacterized protein		CALJA		97
MAX isoform 17		PANTR		96
Uncharacterized protein		PANPA		96
+14
P61244-6	MAX isoform 1		PANTR		83	UniRef90_A0A2I3ST87
MYC associated factor X		GORGO		71
Uncharacterized protein		MACMU		83
MAX isoform 1		PONAB		83
Uncharacterized protein		PAPAN		83
+10

Protein	Similar proteins		Species	Score	Length	Source
P61244	Protein max		FELCA		160	UniRef50_P61244
Protein max		RAT		160
Protein max	)	MOUSE		160
Protein max		DANRE		165
Protein max		CHICK		160
+428
P61244-3	MAX protein		HUMAN		94	UniRef50_Q6V3B1
Protein max isoform c		CALJA		94
MAX isoform 14		PONAB		94
MAX isoform 14		PANTR		94
MYC associated factor X		SAIBB		103
+24
P61244-4	Protein max		HUMAN		125	UniRef50_G3V2R5
MAX isoform 16		PONAB		125
MAX isoform 16		PANTR		125
Uncharacterized protein		PROCO		135
Uncharacterized protein		OTOGA		146
+36
P61244-5	MYC associated factor X		SAIBB		104	UniRef50_P61244-5
Uncharacterized protein		Cebus capucinus imitator		104
Uncharacterized protein		CALJA		97
MAX isoform 17		PONAB		96
Uncharacterized protein		AOTNA		96
+28
P61244-6	protein max-like		DIACI		75	UniRef50_A0A1S4ELX6
Uncharacterized protein		Glossina palpalis gambiensis		74
Protein max		winter moth		83
Protein max (Fragment)		specked wood butterfly		73
Uncharacterized protein		RHIRO		83
+14

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	M64240 mRNA Translation: AAA36200.1 M64240 mRNA Translation: AAA36201.1 X66867 Genomic DNA Translation: CAA47337.1 X66867 Genomic DNA Translation: CAA47338.1 X66867 Genomic DNA Translation: CAA47339.1 X60287 mRNA Translation: CAA42827.1 AK290130 mRNA Translation: BAF82819.1 AK290929 mRNA Translation: BAF83618.1 AK292189 mRNA Translation: BAF84878.1 AK292630 mRNA Translation: BAF85319.1 AL139022 Genomic DNA No translation available. CH471061 Genomic DNA Translation: EAW80899.1 CH471061 Genomic DNA Translation: EAW80901.1 CH471061 Genomic DNA Translation: EAW80903.1 CH471061 Genomic DNA Translation: EAW80904.1 BC003525 mRNA Translation: AAH03525.1 BC004516 mRNA Translation: AAH04516.1 BC013669 mRNA Translation: AAH13669.1 BC027924 mRNA Translation: AAH27924.1
CCDSⁱ	CCDS41965.1 [P61244-3] CCDS9770.1 [P61244-6] CCDS9771.1 CCDS9772.1 [P61244-2] CCDS9774.1 [P61244-5]
PIRⁱ	A38431 A42611 B38431 S33118
RefSeqⁱ	NP_001257997.1, NM_001271068.1 NP_002373.3, NM_002382.4 [P61244-1] NP_660087.1, NM_145112.2 [P61244-2] NP_660088.1, NM_145113.2 [P61244-3] NP_660089.1, NM_145114.2 [P61244-5] NP_932061.1, NM_197957.3 [P61244-6]
UniGeneⁱ	Hs.285354

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1AN2	X-ray	2.90	A	22-107	[»]
	1HLO	X-ray	2.80	A/B	4-92	[»]
	1NKP	X-ray	1.80	B/E	23-102	[»]
	1NLW	X-ray	2.00	B/E	24-99	[»]
	1R05	NMR	-	A/B	22-103	[»]
	5EYO	X-ray	2.39	A/C	22-107	[»]
DisProtⁱ	DP00084 DP01097
ProteinModelPortalⁱ	P61244
SMRⁱ	P61244
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	110319, 151 interactors
ComplexPortalⁱ	CPX-104 Transcriptional repressor Mad-Max complex CPX-91 Transcriptional activator Myc-Max complex
CORUMⁱ	P61244
DIPⁱ	DIP-28145N
IntActⁱ	P61244, 100 interactors
MINTⁱ	P61244
STRINGⁱ	9606.ENSP00000351490

Chemistry databases

BindingDBⁱ	P61244
ChEMBLⁱ	CHEMBL1250363

PTM databases

iPTMnetⁱ	P61244
PhosphoSitePlusⁱ	P61244

Polymorphism and mutation databases

DMDMⁱ	47117704

DMDMⁱ

47117704

Proteomic databases

EPDⁱ	P61244
MaxQBⁱ	P61244
PaxDbⁱ	P61244
PeptideAtlasⁱ	P61244
PRIDEⁱ	P61244
ProteomicsDBⁱ	57281 57282 [P61244-2] 57283 [P61244-3] 57284 [P61244-4] 57285 [P61244-5]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	4149
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000246163; ENSP00000246163; ENSG00000125952 [P61244-5] ENST00000284165; ENSP00000284165; ENSG00000125952 [P61244-4] ENST00000341653; ENSP00000342482; ENSG00000125952 [P61244-6] ENST00000358402; ENSP00000351175; ENSG00000125952 [P61244-2] ENST00000358664; ENSP00000351490; ENSG00000125952 [P61244-1] ENST00000394606; ENSP00000378104; ENSG00000125952 [P61244-3] ENST00000553928; ENSP00000451907; ENSG00000125952 [P61244-3] ENST00000556979; ENSP00000452378; ENSG00000125952 [P61244-3] ENST00000618858; ENSP00000480127; ENSG00000125952 [P61244-3]
GeneIDⁱ	4149
KEGGⁱ	hsa:4149
UCSCⁱ	uc001xic.3 human

Organism-specific databases

CTDⁱ	4149
DisGeNETⁱ	4149
EuPathDBⁱ	HostDB:ENSG00000125952.18
GeneCardsⁱ	MAX
GeneReviewsⁱ	MAX
HGNCⁱ	HGNC:6913 MAX
HPAⁱ	CAB000328 HPA003474
MalaCardsⁱ	MAX
MIMⁱ	154950 gene 171300 phenotype
neXtProtⁱ	NX_P61244
OpenTargetsⁱ	ENSG00000125952
Orphanetⁱ	29072 Hereditary pheochromocytoma-paraganglioma
PharmGKBⁱ	PA30656
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG2483 Eukaryota ENOG4111V1C LUCA
GeneTreeⁱ	ENSGT00530000064011
HOGENOMⁱ	HOG000293257
HOVERGENⁱ	HBG008542
InParanoidⁱ	P61244
KOⁱ	K04453
OMAⁱ	RHTSTAN
OrthoDBⁱ	EOG091G1312
PhylomeDBⁱ	P61244
TreeFamⁱ	TF318841

Enzyme and pathway databases

Reactomeⁱ	R-HSA-1362277 Transcription of E2F targets under negative control by DREAM complex R-HSA-69202 Cyclin E associated events during G1/S transition R-HSA-69656 Cyclin A:Cdk2-associated events at S phase entry R-HSA-8953750 Transcriptional Regulation by E2F6
SignaLinkⁱ	P61244
SIGNORⁱ	P61244

Miscellaneous databases

ChiTaRSⁱ	MAX human
EvolutionaryTraceⁱ	P61244
GeneWikiⁱ	MAX_(gene)
GenomeRNAiⁱ	4149
PMAP-CutDBⁱ	P61244
Protein Ontology More...PROⁱ	PR:P61244
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000125952 Expressed in 240 organ(s), highest expression level in blood
CleanExⁱ	HS_MAX
ExpressionAtlasⁱ	P61244 baseline and differential
Genevisibleⁱ	P61244 HS

Family and domain databases

CDDⁱ	cd00083 HLH, 1 hit
Gene3Dⁱ	4.10.280.10, 1 hit
InterProⁱ	View protein in InterPro IPR011598 bHLH_dom IPR036638 HLH_DNA-bd_sf IPR037933 MAX
PANTHERⁱ	PTHR10328 PTHR10328, 1 hit
Pfamⁱ	View protein in Pfam PF00010 HLH, 1 hit
SMARTⁱ	View protein in SMART SM00353 HLH, 1 hit
SUPFAMⁱ	SSF47459 SSF47459, 1 hit
PROSITEⁱ	View protein in PROSITE PS50888 BHLH, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	MAX_HUMAN
Accessionⁱ	P61244Primary (citable) accession number: P61244 Secondary accession number(s): A6NH73 Q96CY8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 10, 2004
	Last sequence update:	May 10, 2004
	Last modified:	September 12, 2018
	This is version 172 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 14
Human chromosome 14: entries, gene names and cross-references to MIM
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P61244 (MAX_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Protein max

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Keywords - Diseasei

Organism-specific databases

Chemistry databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

Miscellaneous databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

Chemistry databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Motif

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

Keywords - Diseaseⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ