Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein yippee-like 3

Gene

YPEL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Involved in proliferation and apoptosis in myeloid precursor cells.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi23ZincPROSITE-ProRule annotation1
Metal bindingi26ZincPROSITE-ProRule annotation1
Metal bindingi79ZincPROSITE-ProRule annotation1
Metal bindingi82ZincPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • positive regulation of cellular senescence Source: HGNC

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Protein yippee-like 3
Gene namesi
Name:YPEL3
ORF Names:FKSG5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000090238.11
HGNCiHGNC:18327 YPEL3
MIMi609724 gene
neXtProtiNX_P61236

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi83719
OpenTargetsiENSG00000090238
PharmGKBiPA134985092

Polymorphism and mutation databases

BioMutaiYPEL3
DMDMi47117782

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002123891 – 119Protein yippee-like 3Add BLAST119

Post-translational modificationi

Probably ubiquitinated leading to its degradation by the proteasome.By similarity

Keywords - PTMi

Ubl conjugation

Proteomic databases

PaxDbiP61236
PeptideAtlasiP61236
PRIDEiP61236
ProteomicsDBi57279
57280 [P61236-2]

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000090238
CleanExiHS_YPEL3
ExpressionAtlasiP61236 baseline and differential
GenevisibleiP61236 HS

Organism-specific databases

HPAiHPA030501
HPA045621

Interactioni

Protein-protein interaction databases

BioGridi123740, 11 interactors
IntActiP61236, 2 interactors
STRINGi9606.ENSP00000381821

Structurei

3D structure databases

ProteinModelPortaliP61236
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 116YippeePROSITE-ProRule annotationAdd BLAST98

Sequence similaritiesi

Belongs to the yippee family.Curated

Phylogenomic databases

eggNOGiKOG3399 Eukaryota
ENOG4111VJ1 LUCA
GeneTreeiENSGT00390000008364
HOGENOMiHOG000184254
HOVERGENiHBG054215
InParanoidiP61236
OMAiADIHCES
OrthoDBiEOG091G0XLE
PhylomeDBiP61236
TreeFamiTF313936

Family and domain databases

InterProiView protein in InterPro
IPR034751 Yippee
IPR004910 Yippee/Mis18/Cereblon
IPR039058 Yippee_fam
PANTHERiPTHR13848 PTHR13848, 1 hit
PfamiView protein in Pfam
PF03226 Yippee-Mis18, 1 hit
PROSITEiView protein in PROSITE
PS51792 YIPPEE, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P61236-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRISKPKTF QAYLDDCHRR YSCAHCRAHL ANHDDLISKS FQGSQGRAYL
60 70 80 90 100
FNSVVNVGCG PAEERVLLTG LHAVADIHCE NCKTTLGWKY EQAFESSQKY
110
KEGKYIIELN HMIKDNGWD
Length:119
Mass (Da):13,608
Last modified:May 10, 2004 - v1
Checksum:iA35E852DEB1FFBB4
GO
Isoform 2 (identifier: P61236-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCVAQVLTAHLLPPRQALGSLCSPWAAPRVGPLPPAPAM

Show »
Length:157
Mass (Da):17,478
Checksum:iDE3E720F14F48C09
GO

Sequence cautioni

The sequence EAW79925 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0372761M → MCVAQVLTAHLLPPRQALGS LCSPWAAPRVGPLPPAPAM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB098737 Genomic DNA Translation: BAD51378.1
AF305622 mRNA Translation: AAL09365.1
AC012645 Genomic DNA No translation available.
CH471238 Genomic DNA Translation: EAW79925.1 Different initiation.
BC005009 mRNA Translation: AAH05009.3
BC050664 mRNA Translation: AAH50664.2
CCDSiCCDS42147.1 [P61236-2]
CCDS45459.1 [P61236-1]
RefSeqiNP_001138996.1, NM_001145524.1 [P61236-1]
NP_113665.3, NM_031477.4 [P61236-2]
UniGeneiHs.513491

Genome annotation databases

EnsembliENST00000398838; ENSP00000381818; ENSG00000090238 [P61236-1]
ENST00000398841; ENSP00000381821; ENSG00000090238 [P61236-2]
ENST00000563788; ENSP00000457976; ENSG00000090238 [P61236-1]
ENST00000566595; ENSP00000456427; ENSG00000090238 [P61236-1]
GeneIDi83719
KEGGihsa:83719
UCSCiuc002dwl.3 human [P61236-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiYPEL3_HUMAN
AccessioniPrimary (citable) accession number: P61236
Secondary accession number(s): Q65Z99
, Q86VK6, Q9BSJ4, Q9CQB6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2004
Last sequence update: May 10, 2004
Last modified: July 18, 2018
This is version 105 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health